SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018307-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW018307-PA
Domain Number 1 Region: 26-195
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.21e-36
Family SPRY domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW018307-PA
Sequence length 997
Comment hypothetical protein|DS709658:289604:327827:-1|gene:ISCW018307
Sequence
MESWPLNVMTSRRNAWLADYGRLGDHHVTFDICTNVGTFIVDKDRLGVSSQSNFNTIRGT
CCVFKGKWQYELMLGSKGVMQVGWVTSNCKFSQEKGVGDTQDSYAYDGNRVRKWNVSTYK
YGEPWLAGDVIGCCLDLDEGTVHFYRNGRSLGVAFDRVRAGPGLVYFPAVSLAFGENLVA
NFGATPLRHPVEGHRPLEKLDPREAERAWTLVRWVKRLLPVYEEVQKYLTDGLDVFRQGT
KAQALLLAAPVLRRLGPLLASSHVTEVSVLPFLFQVLDENPDGGGISVLLELFWALLEVS
APSAKCHSAARSEAGRRKPGRLCRQPLEVQRCLQNVAVALLSGFRFSPCTPDLHHQKRHL
SLFLSVAHPTEEAYKKSLYAASKQKLKSVALELESLQLRILEQLTTDDDAPQGQTSRDTF
LAKFEDFIKENSPGSRTVTLDLCPPSVALNFFHRLVALLRQCLPVLHAASGKLLQAHSLY
IPGDVFLSDIGVRGEVSRVGDFPELPYDIASNQQSNRTDEGHKASVELSSGTPNAFDKDR
ASTKVFRLLDGIVRLYYLCSHAHFLKMNAVREGMRDYLRAVQEVRRNSALGEPDVVEALA
KAEEVFSDTLSQQARQVAWLSAVVFSKEKQADVYWLLRVVLLTLEEASHSGAAFAFVPDY
YVESCIKLLTSLSFYFPPTCNLSDIPATFPFSLLHRAIITQCFTAHLFRVFLASLSERML
SGNIGLCMQASSRNDTAFTCSSMAMIQALLQPYKNRPWAQTNWILMRLWKGCGFAFRFTI
APHLVQRMSSKPVESALPSHPAPCPSVFFQNHIGRWLEDHPDRAAAFLGSVLTQLNWAFS
QFISMLQEIQNAHFRPERVFVDTRQLKICATCFDLSLGLLRVVEMVVNVAPSLVTHPGRP
HSDLLLARICQLVSQVLNRVTSRCGCFDLVVGMDVAGLEAVDHFPIVAAVTGILVALLLR
GSVDRLCIMTHLVNNRECFFCKALIEKLDSQRPLPPH
Download sequence
Identical sequences B7PGT6
XP_002401445.1.51680 6945.ISCW018307-PA ISCW018307-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]