SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018308-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW018308-PA
Domain Number 1 Region: 1-331
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.23e-49
Family LacY-like proton/sugar symporter 0.054
Further Details:      
 
Domain Number 2 Region: 400-530
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000471
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 
Weak hits

Sequence:  ISCW018308-PA
Domain Number - Region: 339-393
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0981
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW018308-PA
Sequence length 573
Comment glucose transport protein, putative|DS709658:356467:377562:1|gene:ISCW018308
Sequence
FLFGYDTGVVSGAMIQLRSHFQLNYLWQELVVSITIAGAWAFAIVAGVATDVFGRKPVIL
AASLVFTIGAVLMGVAFNKGMLLGGRLIVGAGIGLASMTVPVYIAEVAPADMRGFLVSIN
QVFITGGQFVASVVDGLFSTDSVNGWRYMLALAGVPSLIQLLGFLAMPESPRWLASKGAY
QEAVEVLRRFRGPHANIEPEFEAMKNGCIDVEPVDGQPASSALMQVLKTGPLRMALLVGC
ALMMFQQIAGINTVMYYGATIIQMSGVHDPSKAIWLAAATSFVNFASSFIGLGLVERVGR
RVLVLVSLAGALSTFFLNALPSCSVYVSAISVLPTCWNDGCLTAGRSSPSTCASCTTNPS
CGFCYPGSAGSSANGTCLPSSPNSLDVSSVGECRAGNGTGTVATPGYVWAFDWCPSPYWW
MTILGLLLYLLSFSPGTSAASRGLMTGRAGAARPVRWPWIGITTSSAGVAGLVCWQQVSV
AVGVTGIAGLSAMGLWCTFWLYAGVSALGWLFFFLFLPESKGKSLEEVEDLFAHPWWSDS
TTRDNKKTVQYVHIRGLNHAYTTDEADSGEEDR
Download sequence
Identical sequences B7PGT7
XP_002401446.1.51680 ISCW018308-PA 6945.ISCW018308-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]