SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018415-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW018415-PA
Domain Number 1 Region: 57-143
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000109
Family Fibronectin type III 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW018415-PA
Sequence length 280
Comment hypothetical protein|DS715200:275036:305043:-1|gene:ISCW018415
Sequence
MGSLQGFVCTSPPLGLVLLCTSAWVNALVKSNGSEPQQQFVQQQPSATSLSSGSLVVSVS
RVSDNYAEIAWRREPASSWQSSTSDDPTSTLSGCELAYGPLEDPYQVEVMSNFMPRGPTF
TVGGLRHNATYHFHMVCYCCLDGGVGGNGTTPESAGTKLASNVLKFTTATRSGSPGGGSG
ASGQSSGGGGQSSWQQQDPYKGSYHSVYKQTILRDEDSSRAVPSFNVLLGALTGIVGFLI
INVTVVIAVRRCSHRRMRRRRILVLEERDNEDFPYLRAID
Download sequence
Identical sequences B7PHV8
XP_002403671.1.51680 6945.ISCW018415-PA ISCW018415-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]