SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018440-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW018440-PA
Domain Number 1 Region: 1079-1355,1382-1406
Classification Level Classification E-value
Superfamily NHL repeat 3.92e-20
Family NHL repeat 0.011
Further Details:      
 
Domain Number 2 Region: 765-838
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000011
Family Carboxypeptidase regulatory domain 0.05
Further Details:      
 
Weak hits

Sequence:  ISCW018440-PA
Domain Number - Region: 1307-1354,1394-1575
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000366
Family Tricorn protease domain 2 0.06
Further Details:      
 
Domain Number - Region: 586-610
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000549
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 485-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00121
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 517-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 642-675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00549
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 419-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 449-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 616-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0237
Family Integrin beta EGF-like domains 0.078
Further Details:      
 
Domain Number - Region: 313-381
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0781
Family MarR-like transcriptional regulators 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW018440-PA
Sequence length 2582
Comment N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase, putative|DS733854:9294:117649:1|gene:ISCW018440
Sequence
MDSECESEPPYLPAGLRNGSGSLTGGGATQHSTTDVNRAGLNCGGDPSAKHLDSKGTLGR
SHRSDNERVYCQPQVTHTTNSFSESKSEKDSTDAAVAPSAPGSHGSTYSNPLPEFGGTPC
STTGPMVPVPSCVNPQLIQQSSACGQGAPALGPGSHATGARASLAATSAFASAAMATSRF
HLQKACGGHRCSWKWATLLLTCVVICLAATLAYFAAALSSLGERPEASKSCILVDDAANV
QNMAAERVSLTVKGPSVPSPVGAPSSSSSSASRSSLPSSAVKPPCRPVLPGEVDAYAEVK
LGVRLTRHLDAHDAWNLWFNQPDSAFVRFNITAPQGARLALLARKNEPPSLTARDLVEIV
AMEHRRPYKRSAILEEAEFIHFLEPGTWYLSLINDDSLPTSVAFHPAIARDVPTSCPNNC
HGHGNCHLGKCHCFPGYIGLDCADSVCPVLCSGHGRFVQGSCRCEAGWKGAECGVRDDDC
EAADCSGHGACVQGHCACQPGYAGEQCDRVDCLDPECGSHGACVDGHCLCKIGWRGANCS
QPDERLSRCFPDCSSHGVFDLDQEACVCFDHWTGEDCARAKCSLDCGPFGRCEEGRCRCE
HGWTGPRCDLRECDPRCLRHGQCNNGTCVCIQGWMGLHCTLDGCPEGCNNHGQCVRDGEA
WRCNCLPGWAGPDCSVAQETKCTDKIDNDEDGLGDCADSECCYRPECMESLLCLSSPEPQ
DILLRKQPPAVTASFYQKMKFLIEEDSVQSYSHRDEYSESRVSVIRGRVTSKEGNGIIGI
RVSVATDPQFGFTLTRNDGWFDILVNGGGAVTLQFQRNPFHPIKRTIMVPWNDIVVMGQV
VMSVLSEENPQAGELFQEQSSCDAHSYDKMKPIVYQTWRPGSQGGCTDSSAILAETQVIQ
ETLEIPGSELRLVYHSGHAQGYLSTIHLQLTPSAVPEDLRLVHLRIVVEGILFEKIFEAD
PDIKYTFAWNKRNIYKQKVYGLTTVIVLVGYEYTSCQRTIWTTQSTTLRGYDMDISELGG
WNLDIHHRYNFQEGVVQKGDGSTVYFKHQPRVISVLMGTGQQRPLLCPECNGLARENKLL
APVALASGPDGSVYVGDLNLIRRITPTGQVYTVFRMRTSDVSYQYHLTLSPTDGHLYLSD
PERHQIVRVHSLDKVEDPDSNFDVVVGSGERCIPRDRDNCGDGRPALEAKLSYPKGMAVA
VDNSLYFGDGNNVRMVDSRGIIHTLIGDHQHKRQWRPIPCSGTLHMNEAKLRWPTELAIN
PLDNSLYFIDDHMILRLTKDQRLLVVAGQPVYCKSEDGAAQKSRMGDDSDLGTLISFAFG
PTGMLYVAEVDQRDSYKVRALGPDGELVHFAGRDEGKCPEGSPCENCTSCGSKSSLAVDT
RLQAVSSLTVTSDGVVHIADLGSLRILSAVPYLPEPDDQQEYQVAQPESHELYVFNKYGQ
HIVTRSILTGKTKYTFLYNVNTSFGKLSAVTDTSGNKVAFLRDSGNSLHTIETARGQKCR
VHVTKEKLLESFVDPDNLQTHFHYDSAGLLVTRYDATGKTFHYIYDENGRLTDVINPSGR
LTSLSFDLSDKGASVSAVQEGARSVVTVKGLTVITSRGGVSIETILHQDGAVEVSTPWKA
GAVWEADTHRVLRELLPVQAGMFPVPVRQTLYWDLESANTLQWRYDLKYSRRDGHRSISA
VERVLLVNGTQYLTTEYDWVAAREILYNSSRRPFLVVQYDSFARPVQWLPTETRMPLNVM
YDRLGRFSGWQQGQLSETFVYDRLGHLSEVKLADNAAIKYAYDSISKPFKVILPSGRTFT
FHYDENGGLLHVTTPKETRHSFLVLVSIGFYKVYYTPPGNSGPCIIHFNDRSLPILKIFP
GDKGRVLYRYNEQSLLTLVVFGGGKVETNHTATGLVRSEAWSEEDVEVRHEYYYDGALLT
QCVARFYSKFQLTTANFHYRYNKWFRVKSLSVRIGTLQFPEMEYAYSPKTGRREVVGNFR
FFDVSPNETAVSDGTATFVQQTDPQHRVHQRSLLIGDKEMYRMDVQYGNRDGVIQTKTLM
RLTGGVQLRTQNFSYDEDGQLTEMMGKDHWKFSYDANGNIVTMQYMGNKIEILHDVGDRI
LRFGETPFVVDGRGTRRGKYEVRYFYDARSRLAMRKDHFGNMTQFFYADPANPRLVTHVY
NNADGRSMSLVYDTNDFLIHVLVNKDSYYVATDHNGSPTLVFDKYGEVVKEVYRGPYGHI
IYDSTPLFYVPVDFQGGIFDPLTGLIHFGERIYDSLMGKWMTPQWEEVLQQASNVRKLHL
YQFNQNDPVNLKRDRRSKMDLNDWIQKQGIDISSLGLGRPPILRGAPALLFPGSRTYNLP
LPSVPLVSGYGCAVRRRLESFAQLSSVEKSKVKREQSADNAVPNLSTLNVPFGRGITVSR
TAGRAVIRTVDKADPIQRDVYTSVFNNSLLLDLHLVMHGQDVFYFVKDSTWRFHEDITQL
QRLGTAINTTVHQSKTDEGAQVSDVRIHTAHAILNIRYGTVPHRERLRLLWHAKKHAVSQ
RWAQERQVLLTDQHGGALGWTDKDKEYILRTGSVPGYRGDYYQTSTPSPNWRTTRRTLCF
GK
Download sequence
Identical sequences B7PKH8
6945.ISCW018440-PA XP_002400335.1.51680 ISCW018440-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]