SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018494-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW018494-PA
Domain Number 1 Region: 61-148
Classification Level Classification E-value
Superfamily Immunoglobulin 4.56e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 120-237
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000162
Family I set domains 0.054
Further Details:      
 
Domain Number 3 Region: 224-327
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000738
Family Fibronectin type III 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW018494-PA
Sequence length 346
Comment sidestep protein, putative|DS754816:141978:158363:-1|gene:ISCW018494
Sequence
MATDATKTTSILHLEARADMNGRRLVCKGFNPHLPDSELVDHWILDVHFKPVLQLNMVTM
EAKDQISEGSSVYFDCNVQANPPVKEVGWLHEGGQLAPSPGVRIEHVRLVIDRLHKDQKG
NYQCVATNDLGHGVSEKVFLMVYYPPRCRDKQKGVYHVARHETTRINCEVEADPGDVRFR
WQFNSSLETLDIVSFNQSGPRSSSAYYTPRRKADYGSLICFASNSVGKTATPCVFSILPA
GPPNPPVNCSVPNVTTTSVLVECEPAPQSDPLAVHYFADAYVGARFRARITAFEPRFELG
DLEPGSTLKLVMHAVNEKGASAAVILVLTTLVSTDTELIGMAPCCS
Download sequence
Identical sequences B7PNW5
XP_002435457.1.51680 6945.ISCW018494-PA ISCW018494-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]