SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018509-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW018509-PA
Domain Number - Region: 8-90
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW018509-PA
Sequence length 112
Comment hypothetical protein|DS749722:228741:231957:1|gene:ISCW018509
Sequence
MACIEDEDCQEENNLVCAADEGVDKVCLCDSGFIEDGSRCIDGFTHPGDPCDARMMKCAK
KTNMICDSATKPPRCMCMLGMTWQTNRCVALYVLVLHPTRSTKWVTSERCTL
Download sequence
Identical sequences B7PN11
XP_002435159.1.51680 ISCW018509-PA 6945.ISCW018509-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]