SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018522-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW018522-PA
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-17
Family Clostridium neurotoxins, the second last domain 0.019
Further Details:      
 
Domain Number 2 Region: 218-283,401-625
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000297
Family Armadillo repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW018522-PA
Sequence length 1939
Comment neurobeachin, putative|DS749722:609264:659099:1|gene:ISCW018522
Sequence
MCFRTSKGVGYSAHFVGNCLIFTSMKVKGKGYQHCVKYEFQPRKWYTVAIVYIYNRWSKS
EIKCFVNGQLASSTEMSWFVSTNEPFDKCYIGAAPELDDEHVFCGQMSAVYLFSEALTAH
QVCAIHRLGPGYQSQFRFEGESMTLPESLKRVLYDGKLSSAMVFMYNPMATDSQLCLQAA
PKGNVSYYVHTPHSLMLQDVKAVTTYSIHSTLNSIGGIQVLFPLLAQLDYPMGLLPLPGS
QDKKPTICATLIGFICEMCESSSTVQQHMIQNKGFLVVSYQLQRASREHITDEVLHSFLS
LTKHLLTVYSSNGELLLKHLLDHILFNPALWIYTPTIVQTKLYTYLATEFLGDTQIYNNV
RRVSTVLQTMHTLKYYYWVVNPRNKSGITPKGLDGPRPNQNDILSIRAYMLIFLKQLILK
GNGVKEDELQSILNYLTTVHEDENLHDVLQMLMNLMAEHPASMVPAFDCKNGVRAIFKLL
GSTNESIRLQALKLLGYFLSRSTHKRKHDVMTPHNLYMLLAERLLLHSDHLTMATYNALY
EMLTEHISNQILYTKHSEPESHYRLENPMILKVVATLIRQSKPCEELIEVKKLFLSDMTL
LCNNNKENRRTVLQMSVWQEWLVAMAYIHPCNAEEQKISDMVYALFRMLLHHAIKYEYGG
WRVWVDTLAIVHSKVSLEEYKLHFAQMYEHFDQRRVDHITDPAVRRQRPISTISGLDRCP
PPEQECASQPSREAPPRPDIVQVREGERGEEEEEEERGNVTFPSIVPSTPSQVPDPVPSE
DVVPVVVESSDVTGAALPGPAVVCPDVIPVQESTKSLSEEKRPSLPPADGSSPVSDLSGG
EQGASPDVVPHPTDPTKAHAAEEAAREDADEKLPGEPAESPVEDADVGRMEGVIGEEGDA
RRECIPDAAEMSDSNKDDQSASTDSVSAEREELAVGEGSAECEVFEDARGDDGSEASEEA
ALPEDAADDAAIVSDHGGHADKADPTEPPLQERPEQRAEEGSTEVNSVAQDEPEESESQT
KSVSPAEGPSDSPASLESADETSSTREVASPAQSPEKLSGEPMGSHLPSIVNPTEELDVP
LPPPADDPLPQEGVVVATAVAEKEEPSSLDAVEDGNEDDGDDRLEAKRTIEQTNLLNAEA
SGDAAVISESDAEEEAAVEIGGISTIEAQVEIERRHMADLGFSTTAPMAESASEEGAQEA
GVVRRARSASQTTVEKAVLAPTRPKSVEMAPGTTSGSASAGRQLFNAGPSRPPFRIPEFR
WSPIHQRLLSDLLFSLETDIQVWRSHNTKTVIDFVNSGENAIFVINTVHLISQLADNIII
ACGGLLPLLASATSPNHELDVIEPTQGMAIEVAVAFLQRLVYMTDVLVFASSLSFSDLEA
EKNMSSGGILRQCLRLVCTAAVRNCLECRERSCPLTPVTPLTPQTPTSRDPLRPNPIHAL
IGGVQPSAKNIVENLGGQSSPIRDPEKLLQDMDVNRLRAVIYRDQQQRAEGGHTHHHHAP
PNSASAAGPVPRSAAAAPPHQLGPSSDGTAQQARVEAQMADKSGNAAVLWSESQEGEKDE
VIVVEEMGSSILANIHSSAAVISTSSVPNTVNSVPVAAAYHHPENVNGSGEPEPLTATNP
HNYPATILVPQEPALNGVNKVPEGGVGGNLKAGGPEALRLAPLGPSGVTEGPNTREASLT
QKLEGALGSVCPLLREIMVDFAPFLSRTLVGSHGQDLLVEGKGLSTFKNSTSVVELVMLL
CSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHAEF
ESLCAQTAVDRKEEEMMCDHLITAARRRDSLVAGRALEKVLNILTNRHGAWGYAARPHKG
GTCSPGENEFLRLDAWEDDARRRKRLVRNPHGSCHPEGTLKAAIEHGAPEDAILQAREEL
HRQLAVQSVALAHKGLWLL
Download sequence
Identical sequences B7PN23
XP_002435171.1.51680 ISCW018522-PA 6945.ISCW018522-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]