SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018801-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW018801-PA
Domain Number 1 Region: 55-163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000851
Family Laminin G-like module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW018801-PA
Sequence length 191
Comment hypothetical protein|DS768854:577374:581169:-1|gene:ISCW018801
Sequence
GEHPAQLPDVPVGGPAPLLFQPPQQLRAAPLRKAQARRLHLQLAEVHRAGVCGGPRFLAT
GRIVQVFVDRHADYTVLQVNGNNVTIPHPAVFLTTYYKDPWIQGEQLELVKPARGTFESV
PNSQMYLGGVDFMGATTNLPGLVGCLQGLRIGNVQVDLIKDVENQNVTKGSNSMSSKRSS
CVTFPQKLHLT
Download sequence
Identical sequences B7PQZ2
6945.ISCW018801-PA XP_002436184.1.51680 ISCW018801-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]