SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW018863-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW018863-PA
Domain Number 1 Region: 31-334
Classification Level Classification E-value
Superfamily Subtilisin-like 1.17e-70
Family Subtilases 0.00000000753
Further Details:      
 
Domain Number 2 Region: 328-477
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-38
Family Proprotein convertase P-domain 0.00027
Further Details:      
 
Domain Number 3 Region: 513-650
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.22e-26
Family Growth factor receptor domain 0.00054
Further Details:      
 
Domain Number 4 Region: 686-821
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.39e-22
Family Growth factor receptor domain 0.00068
Further Details:      
 
Weak hits

Sequence:  ISCW018863-PA
Domain Number - Region: 797-875
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000294
Family Growth factor receptor domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW018863-PA
Sequence length 998
Comment furin2, putative|DS748694:54180:95360:1|gene:ISCW018863
Sequence
MVRWCEQQVVKRRVKRDFNLDDVRYQEQFHRSYRIFSDPLYQKQWYLNGGALGGHDMNVA
PAWERGYTGKGVVVTILDDGIQTNHPDLLQNYDAFASTDINDNDDDPMPQDNNDNKHGTR
CAGEVAATALNEYCGVGVAYNASIGGVRMLDGTVTDEVEARALSLNPHHIDIYSASWGPE
DDGKTVDGPGKLAKQAFFQGIAKHGSKPWYLEMCSSTLATTYSSGSPGKDANVVTVDMDL
SFRHKRNSDSLCTQAHTGTSASAPLAAGICALALEANPKLTWRDMQHLVVMTSRPEPLLG
EEGWATTGVGRKVSHKFGYGLMDADAMVVLAEQWTTAPPQHVCRTNSDTTEWVIPNRPGE
SLEVTMNTSGCWGQRDSVRYIEHVQVVVSLQFLPRGSLRITLVSPSGTASHVLLPRSYDV
KEDAFNNWPFMSVHFWGEPAAGTWRLILGSEGIRRSPFPGKLKEWYLIFYGTDSDPVKLR
PRPHNSYIVRDTSASSAHAAVKNRPSRNPCATDAKYQSAESGECVDACPAGQFGSRGSLA
CEACHPDCESCYGPSEDNCLACRAGRYLVDNACWRECPEGSYADPVLRQCVECDRSCSRC
SDNSSFCSACKENYFLHGHSCLGSCPNGTRSMPDSRVCRSCHASCHTCTGESSHDCVTCS
EGHWLYEGQCFTHCPPKYYQGQDGFCRSCKAPCKECSSLKSCKSCVQYYRLDGSSCEVAY
TPCGDGLYSPGGNCNRCHETCATCFGSNEDQCISCPPNKVWSNGRCVSECLLGFYSDAER
TCVQCRGNCRKCTGEELGACTACMHDLILHNGQCIHECPVGSCTGPGEDRCLSCVDGLSL
DPLTWRCLPCCPSDATRATPGTCCVCNRETNECVTGTEHQRSTSWLVHDSATGTYDLSVQ
RVAMTVVGICAGAVAMFFLLFGLLEWSSSTGGGSILGKKVRLADWLRGNGNNGYSRLPGA
KRTASDRARFEVEAEKVALTREDEEEDEEDEEIFHKVT
Download sequence
Identical sequences B7PMP4
XP_002435042.1.51680 ISCW018863-PA 6945.ISCW018863-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]