SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW019061-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW019061-PA
Domain Number 1 Region: 4-116
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000443
Family Calnexin/calreticulin 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW019061-PA
Sequence length 124
Comment hypothetical protein|DS734673:61968:63641:1|gene:ISCW019061
Sequence
MTRRATKDGTAHSVAKYDGKREAEAAAQNHLRGDLSLVLKTKARHHLIATNLDKPYVFEH
KPFVLQDENGGLSHFDDTSTYIITFGPGQYGTNHKMHEIYRHRCPRDGSCKRHWKKYGGI
FKFD
Download sequence
Identical sequences B7PKL6
ISCW019061-PA XP_002400827.1.51680 6945.ISCW019061-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]