SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW019083-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW019083-PA
Domain Number - Region: 288-332,361-408
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00979
Family Fibronectin type III 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW019083-PA
Sequence length 632
Comment calcium activated chlorine channel, putative|DS744786:68647:71755:1|gene:ISCW019083
Sequence
MLLRGYKLTWVFLWPAWSLWFMWCLNVNGDVVLTNNGYKGVTVALSPRLSAENLPPEFLR
DLLELLNSASQAVFKETDDRAFFEEVTLVVPESLDAENFLNGTTIKTSSNPSFKSAHVLI
ESDNGAVFGRSPYTLQYGPCGTPGLRIVLPVSNVLGQNGSAMAQLKKGSKPVRYATVTAR
VTVPDGTEVKVELVDNGAGDPDITAGDGIYSRYFTLFSDKGRYSLSVVAQGSEKTVIVGA
EQQADDLDSRCCGSEFPTTGSRPSGSFTRNVQYGSFFVISQKPPGDIYPPSRIVDLKVLN
VEADTMRVTLRWTAPGNDFDQGKAKGYDIRYFDRAVNFAEDFDTEGTKIDPFNIDGLSGS
PKLSGEIEEASVFNFKCSRGPSSCFFAIRAYDEVRSGPVSNVVEVTFPELTSTDDTDPSF
NPHTDGNGSLVQEDNDRNYARGGLTTWQLGLAVAVPLLIFIVLIILLVMCCFFRRRGNDD
SKESSPPPPTRPRPIISAPMRTKESTPKPVIKDENKNHYAVSVLSGSTISPVNSYSADYL
MDKYEEETKQKQNGVKAPTAPSRSDVGSSDGDTSMDTAVGEQNWWTPRARNSQEMGLPLN
PTYLDRARPANNLGAASSGNVPAVPRRKHTFV
Download sequence
Identical sequences B7PM15
6945.ISCW019083-PA XP_002434813.1.51680 ISCW019083-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]