SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW019254-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW019254-PA
Domain Number 1 Region: 222-322
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-16
Family C1 set domains (antibody constant domain-like) 0.041
Further Details:      
 
Domain Number 2 Region: 317-417
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000233
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 6-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000154
Family I set domains 0.038
Further Details:      
 
Domain Number 4 Region: 132-221
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000265
Family I set domains 0.026
Further Details:      
 
Domain Number 5 Region: 512-609
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000873
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 6 Region: 435-514
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000399
Family I set domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW019254-PA
Sequence length 629
Comment sidestep protein, putative|DS806840:559675:602244:1|gene:ISCW019254
Sequence
MASIVYTAVARGKVALPCDISPPSPEDSVTLVLWYKDESLAPIYTLDSRRGHVGQARQSS
LPEFEQRAHFNMANEPAFLQIDPVEEQDAGEYRCRVDFRKARSINTVITLKVIVPPGDPV
ILDEDGRRLEGLVGRFNEGDDLQLICEVEGGKPRPVVTWWRDKRLVDDNFTVVAGGSTAR
NRLKIRELKRSDFLTVLTCQAANNNVTVAVSRSITLDMNLIPLDVAIQPPKRPLSADQEV
ELVCSSSGSRPPALLTWWKSGEQLVSSKEHQVQEGVSTSSSVLRFTPRVEDNGLVLSCRA
ENQFIPGSAIEEGWKLDVFYKPRVELQLGQNLKEQDIREGRDVYLECLVDASPPATEVTW
FFEDHEVTTNMTTGVIISNQSLVLQKVRRTRRGRYTCSAVNREGHGVSNIFLLRIKFAPV
CKPGQKRLYGVSRLESVSVRCELEADPADVTFHWRFNSSSSGKRLTLASYSNALTHSTAV
YSPNGEDDFGFLLCWGSNEVGKQLRPCNFSVVPAGPPDPVTNCNQINGTEDSVSFECSEG
SWDGGVSPVSFMAQLRDVDSGRRLVANGSSHGLPSFTFLGLPGGSTFSVQVYSINSKGHK
EPTNFIVATLRPAEKLTGKGNKTASSFRH
Download sequence
Identical sequences B7PWA3
ISCW019254-PA XP_002409562.1.51680 6945.ISCW019254-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]