SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW019940-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW019940-PA
Domain Number 1 Region: 2-35
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000834
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ISCW019940-PA
Domain Number - Region: 40-69
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0158
Family MAM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW019940-PA
Sequence length 86
Comment hypothetical protein|DS810267:59850:68313:1|gene:ISCW019940
Sequence
MLLFRCRAGYALNGSSKAFCDGRSWNTSLPRCVPLVANPELSCDFEDPESCGWTADLSGS
NQFTRTHLAAEEGDVSSHGKCRFIYA
Download sequence
Identical sequences B7PWV0
XP_002410271.1.51680 6945.ISCW019940-PA ISCW019940-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]