SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW019960-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW019960-PA
Domain Number 1 Region: 346-436
Classification Level Classification E-value
Superfamily Immunoglobulin 3.94e-16
Family I set domains 0.0086
Further Details:      
 
Domain Number 2 Region: 240-337
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000193
Family I set domains 0.037
Further Details:      
 
Domain Number 3 Region: 146-238
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000033
Family I set domains 0.032
Further Details:      
 
Domain Number 4 Region: 23-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000396
Family V set domains (antibody variable domain-like) 0.081
Further Details:      
 
Domain Number 5 Region: 448-519
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000258
Family I set domains 0.039
Further Details:      
 
Domain Number 6 Region: 521-607
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000991
Family Fibronectin type III 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW019960-PA
Sequence length 654
Comment sidestep protein, putative|DS789119:429410:490929:-1|gene:ISCW019960
Sequence
RPSAIFPFDVRLKSSILSLRTVAHVTALAGGEALLPCDLSPANDSVALVLWYKDALPTPV
YSVDARRGDVSQARHSSIAWGPRAYFATQPPGLRLQALAVGDSGVYRCRVDFRKDRTRNH
ETSLVVIEPPGKPVIREAGSDNREPLRSLIGPYNEGDSLSLVCDVEDGIPAPTVSWWRES
VLLEGSVSEPRPGVRRNALGPFVLRRQDLMAVLACQTSNSNLTAPLSTSVTLDMNFRPLE
VSVESVSRPLEAGKTGWLSCRAVGSRPRSRITWLLGDSALPGAKQNESLDGNVTLSLLAL
RPTAKHHGRLIRCRADNDLIPGSDIFAEFRLQVMFAPKLTLKLATSLRHSQLQEGQDVYL
ECAVEANPPVTEVRWWFGRRELFSNHTAGVLVNNRSLVLQRIQLDHKGPYSCSAVNSQGE
GTSNTLHLNFQYAPVCRRGQKQVYGAASNQPVRVNCEVDAQPGASNFHWRLNNDTLTNFT
WSGHSSQITLVPRLPADLGRLLCWATNQVGTQRKPCVFSISPARDPDSPRNCSIHNRTAT
AFVVECEPGDDGGMPALFVLQVLDELNRTVLRANSSERPVWSVSGLSGGARLSLRLYAVT
AKGRSPVTLLGARTLAGSQSLTEPLWPGSLSPLLVVLIACAVGLVSVAFLVTLL
Download sequence
Identical sequences B7PTX9
6945.ISCW019960-PA ISCW019960-PA XP_002405052.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]