SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020020-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW020020-PA
Domain Number - Region: 5-152
Classification Level Classification E-value
Superfamily L domain-like 0.000583
Family Internalin LRR domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW020020-PA
Sequence length 158
Comment secreted protein, putative|DS818475:33946:34422:-1|gene:ISCW020020
Sequence
MKVWLMLENCSMDYLSPGTFVNTSASILKFKDVQLGSFVEPRSNYNPFEGLEDTLEAMDF
SHNSSLPESWAMLSGMHRMEELRLFKMARLNLTRDYNELPQTMKLVAVVRSTIERVDDDW
LASLRNLEKVAILRSNLVTFSRSMLPRPAPKLWRLTLE
Download sequence
Identical sequences B7PY89
6945.ISCW020020-PA XP_002402716.1.51680 ISCW020020-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]