SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020056-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020056-PA
Domain Number 1 Region: 78-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-37
Family Laminin G-like module 0.00031
Further Details:      
 
Weak hits

Sequence:  ISCW020056-PA
Domain Number - Region: 3-59
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000136
Family Laminin G-like module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW020056-PA
Sequence length 289
Comment agrin, putative|DS840466:723857:725666:-1|gene:ISCW020056
Sequence
MTRGPLSELNLEQPLYLGGLPSEAALSPEAGPREPGLDGALQRLVLNGDAWTDLVGRARA
SERVSSFAGPPCGPAPGPCLNGGLCLPALARHSCSCPAGFGGALCELAFDEAQPRAVAFA
GTSFLHFRHGSREPGEEEEPLGGAPENEVEVRFRSREPQGLLLWTGGRGDHLALALSQGR
LLVSFDLGAQRTELWSESRLDDGRWHTARLQRQGRLATLTVDVGKPLSATATPGATQLNT
DGLLWVGGCPKLPPGLPAPLYLGFVGCLTALTLDGHSVALAGPPCSDEP
Download sequence
Identical sequences B7Q200
ISCW020056-PA 6945.ISCW020056-PA XP_002410296.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]