SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020057-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020057-PA
Domain Number 1 Region: 285-349
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 8.18e-16
Family Ovomucoid domain III-like 0.0052
Further Details:      
 
Domain Number 2 Region: 508-567
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000104
Family Ovomucoid domain III-like 0.0047
Further Details:      
 
Domain Number 3 Region: 133-200
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000152
Family Ovomucoid domain III-like 0.0053
Further Details:      
 
Domain Number 4 Region: 821-841,975-1044
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000336
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 5 Region: 356-422
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000887
Family Ovomucoid domain III-like 0.007
Further Details:      
 
Domain Number 6 Region: 859-905
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000582
Family Ovomucoid domain III-like 0.0098
Further Details:      
 
Domain Number 7 Region: 448-500
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000582
Family Ovomucoid domain III-like 0.0092
Further Details:      
 
Domain Number 8 Region: 573-624
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000832
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 9 Region: 210-279
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000036
Family Ovomucoid domain III-like 0.0099
Further Details:      
 
Domain Number 10 Region: 750-792
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 11 Region: 648-703
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000222
Family Ovomucoid domain III-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW020057-PA
Sequence length 1045
Comment agrin, putative|DS840466:739487:772731:-1|gene:ISCW020057
Sequence
MAYCPEEDSDHSVLRRVPPQPAIHPDSSKKVLRQEAPVSKISSDAAATFGSPTADSDYLS
LNYNHLVTADENDVPPGQGQPPSTPSYQEPLPTCSSPTGLASADDSAEDMLCDRLDVKHG
VPSTGRAQDHGPCSKTRCRFGAECHSDRGQAYCRCRVSCADQLFAPVCGSDGFTYSSECR
LRMTACIRQKRITVAHQGSCDVVDPCLEKRCEWGAECRPTLDGRAADCVCPDKCVSYGDA
RGSRPVCGSDGRDYPNSCELRRASCNAMRDVQHRFTGPCDPCQGVQCPASQVCQLDEQRN
PICRCNGACPGDLRPVCGSDGRTYPNECLLRVEACRSHRSIRIIYAGPCSQGLNPCGALE
CPFDCNIDRFGKASCACPPPCEQVLRPVCGSDGKSYDSACHLRREACLGADEQLRVSYAG
PCDVSAPCHGFHCPQGAFCAPAADGAPSCHCPPCSEEFEPVCGSDGISYPNECKLRRETC
QRSSTGTGLPAVTVAHPGLCSDPCDGRQCPFYGICQGARCTCPPPCPTPLDDPVCGSDGL
TYANECELRRASCRQQRALALASRGPCDTCQGVQCSLGARCESGVCVCPRDCPEALEPVC
DTQGQPYSNECQLRRASCKQGRDLGPPRPCTAAEQDLETGSGDGCSGACRFGAVCGPGGD
CRCELHCDEVGPSVIRVCASDGFWYPSSCHVRQEACRRQKDIRPADGPDACLKGAANKGP
KTCAQSAFGCCSDGVTPALGVNHAGCPSVCNCNRLGSLAATCDAQSSQCACKPGVGGLRC
DRCLPGYWGLHRIADGVNGCSPCQCSALGSVRDDCEQMTGRCVCKHGVHGMKCDQCTDRS
ARLGADGCSSASGPLGACEQCAGGSDDGGPVCGSDGNTYASACQLRQFVCRLQRNLTLRA
PGPCEDAPSPTAGPVRRSTAHRALPEEDALGQDPQDSVGLPLLSTRPTAATDEPQEETPE
EARAPEDLPALRVPEFSGRSYMELPRLQAYTGLSLELELKADAPDGILLYNGQTASGAGD
FVSLALREGHLEFRYNLGSGPVLLR
Download sequence
Identical sequences B7Q201
ISCW020057-PA XP_002410297.1.51680 6945.ISCW020057-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]