SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020268-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020268-PA
Domain Number 1 Region: 242-379
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-41
Family Galectin (animal S-lectin) 0.00015
Further Details:      
 
Domain Number 2 Region: 67-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-34
Family Galectin (animal S-lectin) 0.00051
Further Details:      
 
Weak hits

Sequence:  ISCW020268-PA
Domain Number - Region: 5-64
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00389
Family Galectin (animal S-lectin) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW020268-PA
Sequence length 383
Comment galectin, putative|DS820627:261385:274826:1|gene:ISCW020268
Sequence
MAVCFSVNFACGGVGSDVAFHFNPPIPAQGGGAQHLSSTATGDQKRRSATSSSFQPGVHF
DMLVQEVPMDLPLQPLVPGTIIELTGHVHNHTKRFSINLVTGKGDIALHVNPRFDAGNTV
FNTLRGNEWETEEVVQSVPVQHGQNFECMILVEQMDYKCVFSSSVAFNGVHFAEFKHRLL
FSLVERLNVEGTVTIHTAEQKPPLGTVLPPMEGVGMAMPCTAPVMLPTGLATLEPANEPQ
TVYNPPTPFSHPLPGGRLAPGLMVYISGRPHSEAVSFSVNFACGGVGSDVAFHFNPRFRH
KEVVRNTFVDGDWGPEEKKCHKFVFHPGVHFDMLVQVLPDRFNVAVNGQHYVEYQHRLQP
LSRISHVTVEGDVLIASLRCQYA
Download sequence
Identical sequences B7PYL8
ISCW020268-PA 6945.ISCW020268-PA XP_002403321.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]