SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020313-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020313-PA
Domain Number 1 Region: 124-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000102
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 314-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000759
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 3 Region: 1535-1568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 71-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000044
Family EGF-type module 0.027
Further Details:      
 
Domain Number 5 Region: 30-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family EGF-type module 0.026
Further Details:      
 
Domain Number 6 Region: 361-446
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000118
Family Growth factor receptor domain 0.022
Further Details:      
 
Weak hits

Sequence:  ISCW020313-PA
Domain Number - Region: 1283-1334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00144
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 1071-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00237
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 727-758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00559
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 589-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00939
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 1001-1033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family Merozoite surface protein 1 (MSP-1) 0.04
Further Details:      
 
Domain Number - Region: 932-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0156
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 658-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0156
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 1142-1173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0178
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 517-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 865-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.026
Family Follistatin (FS) module N-terminal domain, FS-N 0.063
Further Details:      
 
Domain Number - Region: 274-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.028
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 453-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.054
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW020313-PA
Sequence length 1631
Comment conserved hypothetical protein|DS813296:220418:265057:1|gene:ISCW020313
Sequence
MSASANRASRGTPLSPATWLVSNATFSSPDVDECQDPHACGVNAECQNTPGSYSCFCPAG
YTGDPTAECHDLDECSRPTACGLNALCLNDVGSYHCGCKEGYSGDPRIQCLDIVGVECTT
HHDCTANAECINNFCHGPSGLCGQGAICSNTPGSYRCSCPPGFTGDPFRFCEDVNECERL
LGPSGLCGQGALCANTLGSFSCSCPPGYSGNGRVRCHDINECAQTFGPNGKCGISAVCTN
TPGSYHCRCPTGTSGDPTVRCKSRSAPFLFLACADPCEDIFCGAQAKCQLDHTGQPICVC
SHGFTGQSNSLPGCVDIDECSANQPCGHGALCRNLPGKFECVCPHGFEGDPYRGCLAKDI
NECEEISEWSPCGANSECRDLKGAYQCLCAPGYTGNPRQGCSPIHVNECTSNLPIDPNGP
CGVGAICINVVGGFQCECPPATTGDPFTTGSQEQAHCSASSCGTNAQCLGTGDRLDCRCP
AGLQGNPFTHCNDDCAVDEDCLEHESCRHQSGGNKCVDVCLRHTCGPNARCLGQRHLPTC
VCRDSFLGNPNDRVRGCQPLLDECFHDADCPESDRCLPNARGVKNCTRTCSKTRCGPNAH
CVGRVHKPICECREGYNGNPGDFTRGCTPIPLDRCHSNIDCKGYEVCKLTQVGIKDCIEL
CLNYECGPNANCIAMDHLAACECLPGFAGNPHDLRRGCMRHLCEHDNDCPDSAVCLLTRN
GVKNCTDPCWDRRCGPNADCITTNHRASCECRIGFEGIPDDIREGCTPIPKCRSNSDCRD
DEVCGVDHNGIRSCLVGCTTTLCGQNTICRTENHISECRCRESFVGDPYNRATGCQIQPE
RCHRDNDCPSIAVCKRSFDGKNDCHDACEGHNCAQGAVCQAVNHRPTCSCKPGLVGDPLI
RGCHIPDECQVDVDCREDLICRPDTTGLRKCVPVCVYEKCAPNAFCVGIHHKAQCSCPPS
TQGDPYNPHIACFPTQPVAEGCTSDDECASHEICVQGGKCVDACEKKQCGPNAVCRAFNH
RASCHCLQDFKGDPDNPINGCRPKDECQVDDDCKRITDVCRTDNTGSKRCFDACQFNKCG
PNSNCVPRQHAYECQCRHGFIRDRENVLGCVERERDECSNHTGCPTTSACIPNTIGVMKC
AEVCISFSCTPDANCVAFNHRGRCSCREGYTGDPNSRDGCRKVPEPECINHSDCPHPNEV
CQFDEAYGERRCQDGCKFLKCAPRAVCVVDNHLPKCSCPNGLYIGDPYDQREGCKQVECL
KDEDCHITKACFPNFYCEDPCVDGCGINAACVAQNHQRICHCRPGYTGDALVRCEEIHYC
DSNPCHASARCIDVPSGYELGQPMCQNPCDHFKCGTNTVCRAEGHAATCECQPHFRGDPA
QGCSRESVVCLSDHDCSSGYACVDEQCRLVCTRESDCASGEKCINSRCVHPCYSHTDCPP
KEACLSAGYCQVGCRKNTDCQLEETCSQNRCQNPCEIKGLCGPNAICKVSNHEANCFCPD
TLTGNPTPIIGCKRPVVTCTGSCPKGLSCIENRYVDECVNNPCHSTGICENTVGSFLCRC
PEGFIGDGFSGCTNPGECPRGDVDCPLNAACDQNGVTKCISPCDRVQCGPHGTCTVKNRQ
APVRGSYYLRH
Download sequence
Identical sequences B7PXC1
6945.ISCW020313-PA XP_002400170.1.51680 ISCW020313-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]