SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020557-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020557-PA
Domain Number 1 Region: 189-286,390-496
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-34
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 2 Region: 509-607,891-987
Classification Level Classification E-value
Superfamily Fibronectin type III 3.87e-29
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 3 Region: 696-799
Classification Level Classification E-value
Superfamily Immunoglobulin 7.43e-20
Family I set domains 0.029
Further Details:      
 
Domain Number 4 Region: 12-64
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000012
Family Fibronectin type III 0.0048
Further Details:      
 
Weak hits

Sequence:  ISCW020557-PA
Domain Number - Region: 613-692
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000355
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW020557-PA
Sequence length 1100
Comment conserved hypothetical protein|DS823433:297368:323878:-1|gene:ISCW020557
Sequence
MFESSATPVYQSSIIQVDGNQTTFHLRNLKPVTMYEVTVTSENMHGTSLPTYALRTLTLS
SEPSYDLPPPAENVTSSGNESSPAIPDVRGCCVQKGVKQERCLRTMCDPSRADETTLTDV
MICAPWANVTFACMADGVDHTGCCRRRGLPEACLGFCKGTVMRVDYRHFRCLEYMPFYGS
CLLEHYGVLPGNPRDLSVTALSKNWAVLKWSPPAKLPETVTRYGLYWRRLGDDFEPYFAV
SNVKSPYLLDRIEPSSDYEVFVVAENKYGSSEGSDRIVLRTQDPVPDKVETTTGYNETAC
CVNARVKDICMPLCSYKMKLADLQYLSPLCLDEMHTLLRCGAGGRDHKPCCQRYGVRDEC
LSICAGEIALSKYDVTALICSRDVGAVLKCMEEGKDTIPTPPEEFHVTFVTPTSVHLVWN
APSGNVSVVEYQIRYEAFNGTVPPHPTEYTQEVNVTTTMAIVDKLTPKTRYSFYVTAANE
QGTSVPSLIVLLTTPEKGVDEKGIQSTISPPYGVDVLHAAVDAIALKWLPPLHLPLNSNL
SYVVRFAPVNTTADQSAWMSVTTPFTSIIIGNLTFNTQYALSVSAKSGGMTSPSSEVVLA
WTDAAIPAFVNLPLVIPNGPIMEGINMTVMCIGVGVPTPTVSVYVNGRLQVQLHQHHVAI
TVPRVSRNVTKVSCFASNGYGHGAHSSVDIHVISSPFVTVPLKKTYTEMGSTARMVCEVS
GHPEPRFLWYRDSQLRNPLGNDEHTESLSSPDPLKPHYYQSYLIVKGVTKEDAGTYFCSA
ENQHGSMAGTVTLSVLERSSRNTTRCCETIGVSRHCMAACTFDIDINFAVNRPQCIQDLD
KLMHCAADGSDHRQCCRTKGVPTGCQRWCVGRPVIHTTQCALAASREIVACFEEGKAMLP
GPPQNVKVRQLSPNAVEIRWDPPIKNPDVVQWYRVLWRHVGSQSINRNETLKAPFNLTDL
PTGLIYEFLVKAGNHYGMSASTLPVVIHSLGSSYQTGLSMGGKIALILVLSALLLVIAGV
LGIFYWKRWKAKAPASGVSFENPTYLKDGVTLQNTSGGGGGGGDSSSKPSEPVENGGHRN
GRPRAVENCYEDIRAVRLSS
Download sequence
Identical sequences B7PZ17
6945.ISCW020557-PA ISCW020557-PA XP_002404455.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]