SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020586-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020586-PA
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-28
Family Galectin (animal S-lectin) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW020586-PA
Sequence length 176
Comment galectin, putative|DS846142:115741:123159:-1|gene:ISCW020586
Sequence
MHPRDDIALHLSPVFSPPPRVVRNSIQQQQWGPEESHGDPFPLVAGQPFEILVLVEHDHY
KIAINGAHYAEFRHRLPVHRVTHVAIDGEVSVGMLHFEGSVQSSSHGGYPKHKSSLPIPI
SGNLGKGLAVGAGALAGAALLKKVNPLKPKKMFKHKHKHGWKGWSSSSSSSSSEEE
Download sequence
Identical sequences B7Q2V3
ISCW020586-PA 6945.ISCW020586-PA XP_002411050.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]