SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020628-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020628-PA
Domain Number 1 Region: 50-156
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000364
Family MAM domain 0.011
Further Details:      
 
Domain Number 2 Region: 167-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000411
Family MAM domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW020628-PA
Sequence length 230
Comment conserved hypothetical protein|DS844967:212268:224458:1|gene:ISCW020628
Sequence
MSAGGYIFFETSFQSSPGPSIVSGPEATSPGAGDATAPTVMPTTRAPETPQLYYESVVLA
TRNITPTGPQGFCVSFFYALEGLSVDRLKVVIMDAATTANITVWESQDNYDGRWTKGEVA
YTYGDVHQIWFEAVPKRRGDPARKFRGYIGLDDILFDRMEEAGDNCLGHCTFEGGYCGWQ
NADTDDDFNWEQGRGSQSFLTGPSRDYSSFGKDEMTGFNDVSPVQWSVVF
Download sequence
Identical sequences B7Q2M3
XP_002410903.1.51680 6945.ISCW020628-PA ISCW020628-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]