SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020634-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020634-PA
Domain Number 1 Region: 1183-1298
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000801
Family Pentraxin (pentaxin) 0.064
Further Details:      
 
Domain Number 2 Region: 143-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000107
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 3 Region: 204-273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000556
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 4 Region: 1069-1178
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 951-1070
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 754-910
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000157
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 262-318
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000361
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 8 Region: 489-541
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000108
Family Complement control module/SCR domain 0.004
Further Details:      
 
Weak hits

Sequence:  ISCW020634-PA
Domain Number - Region: 43-189
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000502
Family Growth factor receptor domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW020634-PA
Sequence length 1305
Comment conserved hypothetical protein|DS844967:327448:349788:1|gene:ISCW020634
Sequence
MASLPADEHCYILNSFEEFEALARRALHEDMHVGPHQNLNSSDCDGLCKEGSECCHLGAQ
CTCGIYSGQYSCLCPKGHYGSGMRGECHPCPQGTYQPSVSSGDKGICLPCPHAHQNSPSG
STSVMQCHCRRGYSAEGHSCRVVHCQKLRPPTNGYLVNSDCGVVFNAACGFRCNPGYRLI
GNSIRVCQQSGSWSGSDPVCEKKKCQTLGTPFHGSIKCSTEAFDFETVCEFECQRGYVLI
GSRKRSCLSIALWDGLPTLCRRDCPPLLAPANGIFSPAHCSETKSAFGETCHLRCNDGFA
SPHQASRECVHPGLWSGNDTAIMCMGDSAPDKPKKENEETMSCQTLVDWELLEASDNSGE
SLMLSVVPAVMPPQLFPIGTSDITYWAQDAAGNKAFCNFSVVVRDREPPMVDSCTSPPDA
FSNGSPSAVVTWIEPVFSDNSGIDPVVWQSHEQGTIFPVGETLVTYVASDASGNNASCIL
RVVVRGEPRCIIPVAPANGDVDCRKTSSGMACRITCLQGYGLQPHVPSEFSCAFDGSWRP
HSIHSFPDCSGELKATLRAAQSGHFIVSPRCPDGVDCSVGDLHIKCPTVQAEPNDAKSSE
LHRKRRSKGAEDIEVSFDITGVCVEIESRRAHTSVVAKKSSSPYAFLEDVASERPIIFPM
CKWTFNGFSMLVKCCFNCITSNSLVRGRLGSTSATPVQENELLLSMKNFFAKLRDAIVKK
ELDLMVQQENVTAKSLEVFEEVYKLSCKVGSVPTGTECIKCPRGTFYNISKTSKNEDPKC
LPCPRGTYQSEQGREACVACPDHRSTVSVQSKNISECKALCPPGSHSMTGLEPCETCRKA
YFQPGYGTTGCIACPNNTRARRRGSVNESDCRALCPPGFVSKSGVVPCHKCPRGFYQLKM
GQKACHRCPLQHEISPSVPLSVLNCSGSFSVFFLSAETSANVSEALSETLEISPCFSEPC
FNGGRCQLLASGFICICPPDYTGPFCRHRVDHCRHRPCLFGADCTSFLGGYSCACPNGTR
GKDCQEDINECDLAPCHHNGTCYNTFGSFKCSCKDGFEGTQCEVDLDECLSTPCMNGGTC
TDLPGSLNCTCPPSFEGRWCETEVNMCQQMPCLNGALCVSHGSQFRCLCQPGYRGKLCEE
DIDECASLSCGNGSTCTNLPGSFRCVCLPGFTGRLCETEANPDFKVYFSGTSTLDTAVIL
GLRQRLTELTACMWLKTTDQFNYGTPLSYATDDVDNTLMFTDYSGFVLYVNGRRVVTDVT
ANDGYWHHVCFTWSSAGGNWGVLKDGRLAEQGMGLADGFEIPGAK
Download sequence
Identical sequences B7Q2M9
XP_002410909.1.51680 6945.ISCW020634-PA ISCW020634-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]