SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020666-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020666-PA
Domain Number 1 Region: 1226-1535
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.81e-106
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000445
Further Details:      
 
Domain Number 2 Region: 1499-1787
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.7e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000034
Further Details:      
 
Domain Number 3 Region: 385-586
Classification Level Classification E-value
Superfamily Fibronectin type III 3.18e-42
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 4 Region: 604-781
Classification Level Classification E-value
Superfamily Fibronectin type III 4.25e-34
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 5 Region: 287-390
Classification Level Classification E-value
Superfamily Fibronectin type III 8.06e-26
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 6 Region: 112-197
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-19
Family I set domains 0.0082
Further Details:      
 
Domain Number 7 Region: 779-904
Classification Level Classification E-value
Superfamily Fibronectin type III 2.43e-19
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 8 Region: 4-106
Classification Level Classification E-value
Superfamily Immunoglobulin 5.09e-18
Family I set domains 0.0054
Further Details:      
 
Domain Number 9 Region: 199-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000883
Family I set domains 0.013
Further Details:      
 
Domain Number 10 Region: 869-983
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000123
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW020666-PA
Sequence length 1795
Comment receptor tyrosine phosphatase type r2a, putative|DS844967:1232805:1302312:1|gene:ISCW020666
Sequence
MVDAPSIVIFPRDQTVVTGRVAVFVCTAVGNPRPQIEWRKNGKRVSTNRYTVVEMPGGSV
LRIDPVRTGKDNATYECLAENGVGEPVRALFVLTVLEENQVPPGFPQFKLLPNLQGVERN
RSALLPCKAEGEPEPRLSWLRNDVPVDMSNPRYSLASGGSLQIFDAQEEDQGNYECIAEN
SVGTAISPMATLFVRVRRVPPYFSIPPEASYEVTPGATLNLTCVAVGSPMPYVKWRQGHV
DLTPESDVPVGRNVLVLENIKESANYTCVAASSLGSIEHVSQVLVQEPGSAPRNLHARTL
SSSTVLVQWDPPKEPNGQVMGYNVYYTTQPSIPTLSWSAQTVDNNQLTTISNLSPQTIYT
IRVQAFTSRGQGPFSSPVQVKTQQGVPSQPRHLRASAVSSTAIQLNWTRPVDPAEMVVGY
ELYWNDTFTQQQEHRSVPDSQSYLLEGLYPDTVYYLWLAARSRMGEGAATPPLPVRTEQY
VPGEPRLVKVAALNSTALTVSWKPPSNRDRNGLIRGYQIHVQEMNRHGDLINDALRYDVA
DENAEERNVTGLQPDTKYSVQVAAVTRKGDGNRSPPKTAHTHGGVPTRPELTARIHTEDQ
RLRVELHWSRPNHTYGELLQYRLRYGRMDGGALEEQELGPMEQHLTVEKLARGARYEFRL
SGRNLLGWGQEAITFVSTPEGEPTSPPQNVTFRLQSPNTVAFSWEAPAAMHRNGHITHYS
VQFRKKSSEFSAEDRNTSRTRMVFSSLSEKTDYTMRVRACTAKGCGPWSQNLTASTPGDI
PSAPTNVQAVATSDQSVEVWWDEMPYFGDILGYQVLYAQTAVEDLDQWAVKMVPLTWSAE
ITGLESHTVYAIQVAAYTRDSLGKLSDVITVKVTPTDVPTQLRAYGVTTHGMILSWRPPT
RLDYIKFNISYSAHKEFYDNQGGLQELPIPPQNVLLDVGTTNITIENLIPFTSYRVNITA
VPRDGSFKPPAKIMVTTAMAAPKPMVKPDALWPISNGDEITVMLPQASEEYGPIKQYYLV
VVPSEFANKDPDDFKIEELMSTPLDEDGPYVTAAFVRQNMPARFTLGDQKVNGGFRNRKL
QPLRRYRIFVRAVVDTLQKNLFTTSPFSDEMSLEMLPQVRLRSPDDVPNVSQIERSRADV
GWIVGPLLLIVFMALFLTLFFILMKRRRRQSKTPAGETTMKLLMNSGDLTATQGGQPGTD
PVEMRRLNYQTPAMVGHPPIPVGQLVAHVDALKANDNLRFSQEYESIDPGQQFTWENSNL
EVNKPKNRYANVIAYDHSRVVLQTLEGMPGSDYINANYCDGYRRRNAYIATQGPLPETCG
DFWRMTWEQHSVTLVMMTKLEERTRVKCDQYWPSRGSETYGLMEVTLEDVQELATYCIRT
FSLKRSGYLERREVRQFQFTAWPDHGVPDHPTPFLMFLRRVRTMNPPEAGPMIVHCSAGV
GRTGCFVVIDSMLERLRHEGTVDIYGHVTCLRAQRNYMVQTEDQYLFIHDAVLEAVLAGH
TEVPARSLAAHVQSLLQTLPGEACTGMEMEFKKLANMKTQSNKFVSANLPVNKFKNRLMN
ILPYEATRVCLQPIRGVDGSDYINASFIDGYRYRNAYIATQGPMAETTEDFWRMVWEHNS
NIVVMLTKLKEMGREKCHQYWPSEHSQRYLYYVVDPITEYNMPQYILREFKVTDAKDGQS
RTIRQFHFTDWPEQGVPKTAEGYLEFIAQVHKTKEQFGQEGPITVHCSAGVGRTGMFISL
SIVLERLQCEGVMDMFQTVRTLRTQRPGMVQTEDQYQFCYRAALEYMSSFDHYAN
Download sequence
Identical sequences B7Q2Q7
6945.ISCW020666-PA XP_002410937.1.51680 ISCW020666-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]