SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020670-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW020670-PA
Domain Number 1 Region: 395-611
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-39
Family Laminin G-like module 0.00084
Further Details:      
 
Domain Number 2 Region: 610-797
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-33
Family Laminin G-like module 0.00084
Further Details:      
 
Domain Number 3 Region: 175-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-30
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 4 Region: 15-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000373
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW020670-PA
Sequence length 820
Comment conserved hypothetical protein|DS844967:1388045:1437917:-1|gene:ISCW020670
Sequence
MVAAGSSFAGGTICECRVDGPCQQICFDLHDGTFECGCSSGYRLSSNGYGCEQYDNGIDV
MLSDDPGRSPSGSRVTERKRTPKSRDDSWPDLSWAEEDASWEISRRRRTGPSDGDSVDAD
EDDDPSGRYESPLNTVAATTTAATSPHDGVAGPAAESCDVLACSPEGRCVQDERRGGVRC
ACSLGTGGPFCDQELELRHPRFSGASYLALPTLRDAHKSMQVSLQFRPETHDALLLYSGE
TPELLGDYFAIVLDKGFVEFDCGMGQGILRSDQPVLLNAWNTLTVYRDRWDAWMQLNSGH
QVQGRSKGLFSRITLRLHVYLGGSPNASLAAGRLGTREGLVGCVRRLEINGRRYDFRTGG
RGDAIGGIDVDDCGGDACSHVVCQNGGQCIATGTERGVCLCALGFAGSSCETPVDIVVPS
FNGSSYLRFSGLGNAHLSFLDVQVAFKPLSPHGVFFYNGCKMDGTGDFVALQMANGYVEF
RFDLSSGTAVLRQAHTLLPKLSSSASPVALGEWHTARASRTGRLGSLSVDEQPRVEAHSP
GAFTQLSLPLNLYLGGVPDPGETAAGAAVLQSFVGCVQRLTINNRPLRLMQEALSGVNVA
NCVHPCVTGPCYNGGACQPRMDLYSCHCKLGYAGSNCQTELGFADLTPSPLSRAGQRLYR
IRGDRLEVQLAFRSFSSHGLLLWAGDAEQRPASDFVSLGLEKGQLTLRYNLGSGEAALTC
NASRVDDGRWHWAHLSRSQQAATLALDKSAPVAVSAPGRLRQLNVHSGLYVGGVGDVSHV
TRGRYKSGLVGCVANLTLATDLHVRLVSHAATGINVQPCL
Download sequence
Identical sequences B7Q2R1
6945.ISCW020670-PA ISCW020670-PA XP_002410941.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]