SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW020889-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW020889-PA
Domain Number - Region: 42-123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000384
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW020889-PA
Sequence length 254
Comment secreted protein, putative|DS876681:191281:207403:-1|gene:ISCW020889
Sequence
CLIALSNVALLLLLPSVSASADFRFPDYRRLICAGFIQLSDQSCSTGWNCYRFAKGSFCQ
DGFCVCRFGYSFGLRNGRLQCVGGLTFGESCSDQRPCSTISRTFCYNGSCLCEEDYVFYE
DRCERQAMFSKHDVDSYVSPPTRFNLLTILIIVAILVVALLFLVNKRSLFFYFPCCMRDT
VNIPGILQAESGASTNHPVNAGILGTTLSPRICVFGKSMWNLYKPPSYMETVLNVQYLPS
YQEAANLPPSPKPS
Download sequence
Identical sequences B7Q7N1
6945.ISCW020889-PA XP_002404226.1.51680 ISCW020889-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]