SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW021015-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW021015-PA
Domain Number 1 Region: 382-570
Classification Level Classification E-value
Superfamily Fibronectin type III 2.32e-21
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 2 Region: 28-97,141-208
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-20
Family I set domains 0.0083
Further Details:      
 
Domain Number 3 Region: 215-338
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-20
Family I set domains 0.0067
Further Details:      
 
Domain Number 4 Region: 335-379
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000449
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 5 Region: 571-617
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00006
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW021015-PA
Sequence length 837
Comment hypothetical protein|DS854257:60887:158831:1|gene:ISCW021015
Sequence
MALPRRKYPVNGSQCIPRGVNFTHLSEPRLVVVKNEPLLLQCSVSSLPELAPVNVTWNHD
GVPQQLGSVLPNGSLLIERVAHHKKKNGRKDDGDYSCLAHTKAGIMFSPPVQVKVARMAK
GFTEEPRPVNAPVGGIARFACHIGAVPPAHYTWQRNLEDLPFGDPRFTQLSSGILQIINT
TASDAGNYRCIAKNIAKTMQSAEAALTVPPTVHHEPPSFTAELASLVSPAARTVRFECDT
QGFPAPEVRWFKDGKPLIINGRIKVLHSEDNKYLPEDRRHVTEEADHHRRKPPNHMLVIS
HLVRRDAGFYQCVASNPAGTSTLAARLQVNASGDAPSPPSDLTARTLSSTSILLSWSPPL
SPGNRVVQAYSVHYLPTSVPLPPSLYLSVVNSTTLEARWFLLPEEKSAISGFKLRLREQG
SLMTEPIVLPNSSFSYVLYDLKPQTWYEVHVLCFSNFGDGQEAVQTVLTHPENLTAEGDI
AEPTSSRSIHLSWRAPVPAQNISYYTVRYSAVRPKSVHNSSMVQYIPSTKTEVVVADLQP
STLYGFAVKSHGADSHMSHFSQLIECKTSEDSTRLTSVLNGLAINTVYSLRLQAQTSAGR
GPLTQVIKFVISGGYPQCNGKTNGHAKDKRLRDVTLNGHVGNGSAVHTTNSSPPCYNNRD
PESRLPLPRSQHRYDASDCFLQTEGGPWTEGRTSAPTPLLGDHSSAAWRDIEEPTTAAEE
EQATLETIVSADNSFVSHRDVASDTTNTSPPLRQRGIVECECLRVVSAALYDWRGQRGQR
GAWVVGRGARPEPRAAAARRAATPVAAARASLRLLWGCGAGSAGVPVAAPGSAGSAP
Download sequence
Identical sequences B7Q4A6
XP_002400121.1.51680 ISCW021015-PA 6945.ISCW021015-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]