SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW021328-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW021328-PA
Domain Number 1 Region: 15-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1e-42
Family SPRY domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW021328-PA
Sequence length 541
Comment Domain in SPla and the ryanodine receptor, putative|DS876757:1081625:1098326:1|gene:ISCW021328
Sequence
QSSDRLKLLYPTVNEEETPLPRSWSPKDKFTYIGLSQNNLRVHYKGIGKNHKDAASVRAT
HPIPAACGLYYFEVKIVSKGRDGYMGVGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSS
GTGQPYGPTFTTGDVIGCGVNLIDNLCFYTKNGHNLGVAFTDLPPNLYPTVGLQTPGEVV
DANFGQSPFVFDIEDMMKELRMRTRTTIERFPVNDKQGEWQTTLHRIVQTYLVHHGYCAT
AEAFALSTGQSFDEDLSSIKNRQRIQKLVLAGRMGEAIETTQKLYPGLLEGNPNLLFLLR
CRQFVEMVNGTDGEARPARRSPGASPRLLLLSSSPKASPDVASNGVAPDDQSTANGDASL
NGNHGTDEDCMADMVVEGGEGRTVVSNGVDVDSRQHNGHLHRLEPCGTEADMEVDPPKRQ
LCGGSQAAMERMLQFGRELHVMSIQLKHEYGTNKNNRKMIQDAFSLLAYADPWTSPVGFQ
LDPVQREPVCAALNSAILESQKLPRRPPLELAVAHSRELLKLMSKAGLGSCAFANIDSLL
Q
Download sequence
Identical sequences B7Q7P9
ISCW021328-PA XP_002404276.1.51680 6945.ISCW021328-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]