SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW021414-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW021414-PA
Domain Number 1 Region: 189-383
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-42
Family Laminin G-like module 0.00075
Further Details:      
 
Domain Number 2 Region: 6-179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.43e-25
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 3 Region: 394-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-16
Family Laminin G-like module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW021414-PA
Sequence length 554
Comment conserved hypothetical protein|DS866317:745081:753536:-1|gene:ISCW021414
Sequence
RQPSEATFRGHEFLSLEAGRAAIVSGADQVSLLFKTRQPSALLWHSGDGADYMQLSLKDG
GLLLSVSLGAGVLEKTVRPARVRFDDNQWHRVVVHRKVRQMSQTTSFYHVSLSITADGVY
TERGSTAGSFSFLASSALYVGGTDAILAGPKRNNFVGCLRKVELVADSLQLDLIDLSRSG
NRLVQAKGNIHFVCQEVDAADPVTFTTRDSFLALPSWDDPRTGSVSLRLRTVEPDGLLLY
NSGSQGDLFALELLEGQLHLLLDLGSGPVKVRASPKRLHDGHWHQVQVTRSGRSGRLSVD
DAGADYVTPGNSNQLDLEGPLFVGGVGTTAREDASSTLPGELWSGALRLGFVGCLRDLVV
NGKAVDLASYAQRQDSGAVRPSCHRAGPQCPSTPCLHGGKCSEGWNRFLCDCGHTGFTGP
VCAKEATTLRFNGEQFARIQLGRSSRSEAEHLRLRFQSPRPNGLLLATAAEARPQAPHTA
LVLSLESARLKFAANLIFAFCMFACFLNSIPFFMTQIFYVGQGLDDDRWHSMQLDRRGHR
VELKVDQDTTAGGN
Download sequence
Identical sequences B7Q682
6945.ISCW021414-PA ISCW021414-PA XP_002411930.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]