SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW021721-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW021721-PA
Domain Number 1 Region: 187-285
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000297
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 279-375
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000439
Family I set domains 0.031
Further Details:      
 
Weak hits

Sequence:  ISCW021721-PA
Domain Number - Region: 533-611,676-696
Classification Level Classification E-value
Superfamily NHL repeat 0.0942
Family NHL repeat 0.029
Further Details:      
 
Domain Number - Region: 582-697
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0955
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW021721-PA
Sequence length 707
Comment colmedin, putative|DS852053:135177:196420:-1|gene:ISCW021721
Sequence
VPVLEEFCFTSKEYCGPGDPGHPGKPGVPGYPGQKGDMGFRGLPGIPGSPGPEGPIGPKG
QKGDTGGPGEPGAPGLDGRDGLPGPPGLDGIPGPQGPDGPRGKDGVDGTNGLPGVNGTDG
VNGASCCSSIPPPPFPAKCLPGSRGKRGLPGIPGTPGIPGINAWTVESKIPTDTEQLLSK
LRTINVPPSIVGSDTVQTFHVEEGKNFQLTCSATGQPRPVVTWRRTDGAAIYGNRWHESY
VEDRVLNLTRISREEMGGYVCIASNGIPPTARMDVSLEVRFAPFIRIKQWAVGTEIGGWA
LLECVVEAFPPAVNTWMTGTGRLIEHSPKHEIKEVEEGYKALMTLNISNIESEDLGYYSC
VSRNLRGQASGQLSVYGDSMRTAAGPLDQNGPWVTILNDRRNVEKEKKRADAAGSMGQAT
NNQLAKWHIHICIYNALNCCKPLRKKYAADIAECLMTRRSIQRVGKPVLYRQSTSRWTNW
MRDSESLGPDVFYVANGEDRTALLEFPSKAAFRNGSDPRILKLPTPAHGNAQVVYNGSFY
YHQNDTNQIVRVALSGPGRGRLGLEDVAFRNDSYLYTNQAGNYVNILADENGLWIIYSSR
RSNNTMVLKVDEQSFRPEFIWNLTLDHRKVGKLFVVCGVLYGINSLTEHRTELGFAYDLY
TESLLEGVRLNFSNPFGNTTFLSYNPGDGSLYSTDDQHQLLYPLLFN
Download sequence
Identical sequences B7Q3V3
XP_002411399.1.51680 6945.ISCW021721-PA ISCW021721-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]