SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW021946-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW021946-PA
Domain Number 1 Region: 242-351
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000021
Family I set domains 0.033
Further Details:      
 
Domain Number 2 Region: 156-246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000277
Family I set domains 0.06
Further Details:      
 
Domain Number 3 Region: 323-453
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000149
Family I set domains 0.046
Further Details:      
 
Domain Number 4 Region: 458-487,543-585
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000876
Family Fibronectin type III 0.0088
Further Details:      
 
Domain Number 5 Region: 33-141
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000088
Family I set domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW021946-PA
Sequence length 651
Comment sidestep protein, putative|DS928415:260964:319804:1|gene:ISCW021946
Sequence
MQNRKERNSLRDQRPLEPPVIRDDAGAVLNETAGPYAEGDIATLVCQVKAAGSPAPEVQW
LRRAWRPSTPEEPGIGGAEAVSGSAVTTVSSALDDTQGSVLVLSRLRLGPLSREDLHSRL
FCQVDNGVAAPVRTAVRLDMNLAPLTARILRASGGALTAGLPVELVCESQGSRPPAQLTW
YKRGLEVAQSFGHASADGNVSTSVVTFTPSSKDHGQNLRCVARNPALPPTARAPFDRWVM
NVYYKPEVTLKLGSPFRDGRIHEGNDVYFECAVNANPAASEVHWSKDGVVDFATRTSNGS
ALADVIVSGRFLALQKARRTFSGQYACTATNSEGSAMSNSIRLKVQHAPACIDGVPVVFS
ASRHEPVRLTCRVAAAPGGVTFRWLFSSSNRKVELTEFVVLARGSEGGAEDDDEAMPTAT
SVLEYTPQFQSDFGTLLCAAENAMGVQKDPCTFHIVQAGPPEPLENCSVSNLTERGFWVE
CREERPSAGGVSVATAVPGSAVAAAQRPSLWSRGQEPLVYLLEVYGPPEESSPMRGVSAS
QHQVLLLNVSGPEPRFRVGQLWPGTEFEARVFAANAKGRSRPFRLSACTLSSAEALLDKG
NWCGQITQTVPVSRSGSSIIATKDEIMVLDKRSTQCGLFILSPPSMLGNTC
Download sequence
Identical sequences B7QFW9
XP_002401031.1.51680 ISCW021946-PA 6945.ISCW021946-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]