SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW022144-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW022144-PA
Domain Number 1 Region: 32-402
Classification Level Classification E-value
Superfamily L domain-like 1.19e-51
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 415-524
Classification Level Classification E-value
Superfamily Immunoglobulin 6.59e-17
Family I set domains 0.021
Further Details:      
 
Weak hits

Sequence:  ISCW022144-PA
Domain Number - Region: 581-639
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000915
Family Apolipoprotein A-I 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW022144-PA
Sequence length 867
Comment N-CAM Ig domain-containing protein, putative|DS916551:91307:94063:1|gene:ISCW022144
Sequence
MQQECPARGVLLLVTYAAVAAVLLAGLPHGLASIDPSVTHVHASLQDDDVSSNCPAACTC
RHKDQGALEAVCSRQVLKVVPFDVDPRVTLLDLSFNKIDSLDDNAWSGLCNNSCSLKSLN
LHQNQLLELGFHSFYSLRTLETLDISDNHLNDINLNGFDGLEALVSLNLSGNQLEGLKHE
WFQDLTNLTMLDLSRNRIHELNNVVFWSLHKLVHLRADRNWITSVGLLSLKGLDSLRTLN
ISHNQIAMIQSGTLRPTLEVLDISYNPIRSLQLVFKHTHKLRRLYASHLRALSRLTKESF
EGLDSLEELLMTNCRSLETVDPGSLQSLGSLRKLDIRFNNFTTLPAGLFLPLVQLQRIQL
HGNPWFCDCRLHWLLLWLDHVPAHLLSPSATLCAKPLRLSGHTVLDAVDKHMTCTNATVV
QHTNQAHYRLGSSALLYCEVEGSPEPSITWVTPHRLVFNWTREYGASVGNSSINGPVGRN
DTPKFVLLENGKLFIREVQRGDSGYYRCQATNVLGRHTVAIHLTLDYDFLIRVKIVSVLV
GCATALAFVLATLIGILVSAILRRFGLTCPCDVGANSPRAKQLYRMLESLEQYRCQQLER
LRDNYAGQVQRIKDNCVLQMEKLRDSYSGQTERLRDFCDYGTAQIDRIRDNYYMQVQRVR
DYGVSQIDRLRENYVFQRNRIRKFSTTHLYKLRENYKLQQQHLNKILENLNLESCRSVCA
RTDSIIFDPAELGLMPPPPPLDILPLPLFLDQLDTESQLSAYYTPDSLSEVSPDEVVLQP
HFPFEDTCFNDDLEARSRLFVSMEDVPSSSANNPSSIKVDAASVSDAPSTSGENGNHKTV
PLEVTVHHYEATAEADAAEDISHETAV
Download sequence
Identical sequences B7QDW4
6945.ISCW022144-PA ISCW022144-PA XP_002413728.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]