SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW022276-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW022276-PA
Domain Number 1 Region: 811-1038
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.05e-40
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 2 Region: 1065-1270
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-33
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 3 Region: 357-486
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-32
Family Cadherin 0.00068
Further Details:      
 
Domain Number 4 Region: 209-313
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-24
Family Cadherin 0.00035
Further Details:      
 
Domain Number 5 Region: 95-216
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-20
Family Cadherin 0.00081
Further Details:      
 
Domain Number 6 Region: 467-583
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000108
Family Cadherin 0.0021
Further Details:      
 
Domain Number 7 Region: 1312-1353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 1274-1330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000093
Family EGF-type module 0.026
Further Details:      
 
Domain Number 9 Region: 42-84
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000171
Family Cadherin 0.0058
Further Details:      
 
Weak hits

Sequence:  ISCW022276-PA
Domain Number - Region: 315-369
Classification Level Classification E-value
Superfamily Cadherin-like 0.000518
Family Cadherin 0.0082
Further Details:      
 
Domain Number - Region: 584-646
Classification Level Classification E-value
Superfamily Cadherin-like 0.00104
Family Cadherin 0.014
Further Details:      
 
Domain Number - Region: 741-836
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0408
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW022276-PA
Sequence length 1518
Comment Gb2-cadherin, putative|DS921134:519814:597274:-1|gene:ISCW022276
Sequence
MDVRTSSMVVLLFTVVERNGRFFRGGVVPVTKYIRIGIGDKNDNPPYFGQALYEAEVNED
EDVQHTVITVTAKDKDEYNLNENHTTVLIKVKDVNDNAPIFDRPTYEAQITEENDRNLPQ
KILQVTATDGDKDRESLIVYFLTGQGVDEDLGNSKFAINTTTGEIYVLKPLDRDLPHGRS
QWRFTVFAEDEGGNGLVGFADVLVNLKDVNDNAPFFPSAIYTGNVTENGTAGMTVMTMTA
TDYDDPNEGNNARLTYSIEQNQVNENGELIFTIDEETGVISTAVCCLDRETNPEYTIKVV
AVDGGGLKGESCCHVLNLPLDYEDLQQRFGFNITIQVSDNGGESTDPYHADYAKVKVRVK
DINDNKPEFERPNIEVSVPENSTVGSSLATFKATDADQGGKSRVSYMIDRSSDKKRQFKI
NPNGVVEIQRTLDREDIPRHQVKILAIDDGVPSRTATATLTVVVSDINDNPPRFQYDYRP
VIPEHTPPQKVQEILATDDDDRSKNNGPPFTFRMDPNAPELIQQFFRVEHDPTGANGDGM
AVVRSRETFDRETQKEYLVPILIKDNGNPSLTGTSTLTVIIGDINDNRMHPGSKSIFVYN
FKGESPPTKIGRIHVEDLDDWDLPDKTFFWENNNAHPNFDMDGITDEDFIRVWDWKKQRQ
VKSKYEIFRDLIAELIKTKPYNVDIFSVILKQSRPPITDIRFSAHGSPYYKASLLNGVVA
VNRREIENKVGINITMVGIDECLLENHNCEGSCTNVLMIDRNPVMVNANRTSFVGVNTWV
KAKCTCGARDFSEIESCRKRPPPCYNNGRCVDTYTGISCRCPSGFHGPQCQQTTRHFNGK
GWAWFPPLQQCEESHLSLEFMTDRATGLLLYNGPISRPDPGELVIQDFISLELNGGRPRL
LLDFGSGTAELLVQVEEALNDENWHRLDVFWDRQSVRLMVDNCLSARTHEGNQTIDRSRC
ENSTQVPEFNEFLNVNTPLQLGGTHVGGKDLGAYAWQYRHTTEGFQGCIKNVIHNSEMYD
LGSPGSSYNSVAGCPPAESSCSEAALLHQSCGHGHCLGTYKGAECVCDPGWHGPNCDRET
QSKMFQQSSYIKYALPFDPHPYKTDIQLQFRTRQKHGELFRITSKHGREYCILEIRDKKL
RFRFNLDRSRTSDERELWLPWVWVNDGQWHTVRALRHGASASLALDGGSGRRYNELVDWH
SPHQHMWVEKQNVIAGGDVQYVGPGVTVVDNDYQEGCMNDIRLDQHYLPMESGSEYAAVV
EWRNLIDGCPSNNPCHGISCPRPFVCVDLWMLHECKCSPGFAITENGKNCTDADECLSEP
CLNGGTCMNRPHGEGFYCLCPDGFGGDLCGALRQEKIMRLSMAALAAILVCLLNILILVL
VIVAYTRSRRSDQKFGHGGVDDDVRENIISYEDEGGGEDDMNAYDITPLRIPVDASGTPL
GAKPGPDKAPPLLKEVRLREHNTLWPFCVDTHVTPPFRKEGTGKIYDRHGKRINVFPDVP
AMLECLTSQRYLLGLASR
Download sequence
Identical sequences B7QEF7
6945.ISCW022276-PA ISCW022276-PA XP_002413931.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]