SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW022820-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW022820-PA
Domain Number 1 Region: 576-780
Classification Level Classification E-value
Superfamily Fibronectin type III 4.9e-45
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 2 Region: 781-956
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-29
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 3 Region: 96-197
Classification Level Classification E-value
Superfamily Immunoglobulin 1.79e-20
Family I set domains 0.037
Further Details:      
 
Domain Number 4 Region: 6-90
Classification Level Classification E-value
Superfamily Immunoglobulin 2.75e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 5 Region: 379-478
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-17
Family I set domains 0.024
Further Details:      
 
Domain Number 6 Region: 282-383
Classification Level Classification E-value
Superfamily Immunoglobulin 2.73e-17
Family I set domains 0.026
Further Details:      
 
Domain Number 7 Region: 190-286
Classification Level Classification E-value
Superfamily Immunoglobulin 3.17e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 8 Region: 476-581
Classification Level Classification E-value
Superfamily Immunoglobulin 6.75e-17
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW022820-PA
Sequence length 958
Comment cell adhesion molecule, putative|DS922315:1164144:1230521:1|gene:ISCW022820
Sequence
PLRASVKPTRVSASIGHSLRLNCSTEGYPVREVSWTKDSRPLYTSDRIKIIYNEVLVVNG
VKRQDRGMYQCFVRNRFETVQAASEVIINGENTHEPPVLENIFPESIHKPGGSVSLRCTA
TGNPLPQVTWDLDGRHLPETIRYRVGDYVTRDNRVVSYVNISSVRTEDGGIYRCRASNDV
GLASHMARVNVYGPPTIRLMGNVTALSGGNLVVHCPVGGYPLTAIRWERDGRTLPSGHRQ
LVHANGTLVVSEVNRKADEGTYECVAENGRGDIARRALHVHVMVGPKVDPFKFPSDLEEG
MRSVVVCVVIDGDPPVFIGWLKDGRPLTQDLGAHTEMLNTFTSSLTFHSVGPKHSGNYTC
VARNPAAAVNRSATMTVKVPPYWRKQPMDKAGILGESVLIDCQADGVPHPQIRWKKMIPG
PPVESQTIISNPYIQILENGSLVLREIGLNDAGEYMCQATNNVKPSLSEVIKLRVHVPAF
FKTQFSSQNVRKGEDVRIRCEAYGEKPINITWTKDRQILNFDTETRYKETSTTFPERLVS
EILVKATDRRDSSLFTCMASNAYGRDETNFQIVVQEKPDSPRNLNIKEVTSQSVAMAWMQ
PYSGNLPLTSYVIQYKKDSEQWTPDVMSARNSPSDLSVVVRNLNPVTTYNFRVLAENSLG
HGNPSEVVSVITKEEAPSNPPTEIQIEPTSSKSIKIKWKAPPSEERRSPVKGYYLGYKLH
RSGEQYVYKTLESARNGEIEEFLLSNLRRNTEYSIRLQAFNSAGSGPASEEIVAKTLEHD
PPSPPSIRVQSTTATSVHLVWEPPDIPVNGYVLHYKEDQNDWVKQHVPGTQQSIVLEQLR
CGTRYQLYMEAFNDAGKGDPTQVLSVKTEGTAPVAPDKASFLVINSTFVLLHLGAWYSGG
CRISFFVAQYKPRGESEWTLISNHVQPQTEALLVPQLAPGTWYNLLMTAHNDAGSTDA
Download sequence
Identical sequences B7QEU1
ISCW022820-PA 6945.ISCW022820-PA XP_002414055.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]