SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW022831-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW022831-PA
Domain Number 1 Region: 670-877
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-41
Family Fibronectin type III 0.0002
Further Details:      
 
Domain Number 2 Region: 879-1061
Classification Level Classification E-value
Superfamily Fibronectin type III 1.91e-31
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 3 Region: 476-576
Classification Level Classification E-value
Superfamily Immunoglobulin 9.79e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 290-383
Classification Level Classification E-value
Superfamily Immunoglobulin 1.94e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 103-191
Classification Level Classification E-value
Superfamily Immunoglobulin 8.56e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 569-676
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 4-99
Classification Level Classification E-value
Superfamily Immunoglobulin 3.93e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 192-292
Classification Level Classification E-value
Superfamily Immunoglobulin 4.28e-18
Family I set domains 0.022
Further Details:      
 
Domain Number 9 Region: 378-479
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000111
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW022831-PA
Sequence length 1073
Comment cell adhesion molecule, putative|DS922315:2127672:2192128:1|gene:ISCW022831
Sequence
TSNYLPPRIRRLKQTVRLSAGDPLRLACVAQGYPAPSYRWFRKDDSLVLPVATGGGGRVR
VFRGFLLIQSTVRQDAGTYVCAANNSAGEDRTQFEVVVTMSLKVSVSPGTVLTQEGKTVV
FNCSVRGFPVSSVSWMKNQQLLVPSNRVRAVGQTVLHISGVQRADRGMYQCVAHGHDSSA
QGAAQLVLEENPPDFLETFPDQLLKPGSAVSLKCSVTGNPLPQISWFRYGRLLSDRSGLR
IGDFVDASGVVTSFVNVSSLATEHGGVYSCRAENELASVEHTARLSVYGPPFVHRMDNVT
HVSGSDARMQCAASGYPITLISWKKDNEGLRPSSRLVSSDNGSLHIVHVSQSDQGWYECA
VSNKKGNTAVGSMFLRVIAKPVINPFLFMKNLQEGMRTTVVCSVLSGEPPVEIDWLKDSA
PLSEVHPEAKITRLGDFASSLTMDNVTRRHSGNYSCKATSGIATTNYTSRMDVSASPRWM
KQPSDQSSTRGQRTVFDCEADGNPLPVHRWKKNEKLSEFRSVVSSPHMHVLENGSLVIVE
VTPKDQGHYLCEASNGVGPALSVAAYLQVNVPPYFHEEFETKTVRSKEDVTISCEVFGET
PLTVAWSKDRRPFGDLALPRFVLQEDTTAEGIVSKVFIPSVGREDSGVFVCEATNSFGKK
DRTIQLIVQGPPDIPRDIHVDQVTSRSATLFWTQPHTGNSPLLGYTVLYVPEADKVTSAP
SSLRTGTSENRATVPGLVPGTAYILRVVAENAVGKSGPSDEIRVVTEEEAPSGSPYEIRI
TATSSKTVHVRWKSPLQSTYHGKLKGFHVGYRQLNSRETFQFQTVNVEDDEAKKEPKDNE
FEIRGLRRFTQYAVVVQAFNNKGAGPLSEEATVQTLEFDPPSAPQLMITSKSSSTLELEW
KFPEVTETPITGYVVHYKSEYGEWQETQVNSKLHKHLLTNLICGNRYQVTITAFNAAGRG
VPSELVNAETTGRGPIPPQDKSWSVLMANSSSISVNLDGWSDGGCPITFFVVQYKPHMQP
DWVLLSNNIRMAQSPVTIPDLAPGTWYDVMVSAYNDAGATEVEYRLATLTLSG
Download sequence
Identical sequences B7QEV0
ISCW022831-PA 6945.ISCW022831-PA XP_002414064.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]