SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW022951-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW022951-PA
Domain Number 1 Region: 849-961
Classification Level Classification E-value
Superfamily Fibronectin type III 2.28e-20
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 462-562
Classification Level Classification E-value
Superfamily Immunoglobulin 6.06e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 3 Region: 166-264
Classification Level Classification E-value
Superfamily Immunoglobulin 4.13e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 759-866
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 560-664
Classification Level Classification E-value
Superfamily Immunoglobulin 5.87e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 6 Region: 657-754
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000836
Family I set domains 0.018
Further Details:      
 
Domain Number 7 Region: 257-305,332-342,389-449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000207
Family I set domains 0.073
Further Details:      
 
Domain Number 8 Region: 9-61
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000169
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Weak hits

Sequence:  ISCW022951-PA
Domain Number - Region: 75-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000147
Family I set domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW022951-PA
Sequence length 1009
Comment nephrin, putative|DS939604:59340:111812:-1|gene:ISCW022951
Sequence
FDPSIPGFPRYTMIVDTHRGVYNLRIQNVQLEDEAEYQCQVGPAHKNHAIWTAAQLNVLV
PSKEVELRHRGNGSVVEVREAEHVNIACWVRNTKPVSHIKWFRNGSPLPKAKNILTACRM
FCSLLLLNFLSFRLLRIKHLENQTKPFICRREIFIKYFLRRSAIYPPGVPEIEGYQDGDI
VQVGDTLTLACISRGGNPPATLTWTKDGVLLTAKYKNATREATNTYTFTVTAGDNNAVYR
CEATNLVTLQPFEASVKLSVLFAPSRVSITGPKEAKAGDMVTMTCTTAPSNPSVDVAWKL
DGSAVQPASDQSTVQTKEGWVTSSNLTITLTRQVIDSFSFTCLAESQKLQETVIQSASLK
IIYPPRPPVIIGYEEGTPIMAHSIQRIKCVSIGGNPLPTVKWYKGLKEYASLSTVTGSGV
SSVLEIMAQPDDNQATYSCKAANSATTKPLTTSIKTTVLFAPKAVSITVVPQAPKEGDTV
VLTCESGSSNPESSIQWLHNGNPTASHHQSRVDAQHGGKATRSRVRLNVTAADDGAVFTC
RASNDIQEGAQDSVSLRVLHKPLFLHPPMEKYEVKQGETVLLNVSARANPSKMNYAWTKD
GVPLPGPDDAYSWQETVAHKVFYRGPALHVYQAQKEDSGDYECEASNSQGATKTTIIVKV
LYPATVTKISKYAMVGTGENASFECVVDANPLTEDVIRWRRQGFDMRRRTRVVLEKGRSY
LTVYNVSDLDKGAFECVAHNGLGEEFVRSTLLIVKFKAVMHSPREPLTTVAADVGRSLRL
SCSADGAPKVTFVWTVEDAVIAETATGGHRHAIHVEQLDVLRWESVLVVKYVHAQDYGQY
SCTARNELGSDSARFRVRPRGKPDPPESIRVLNATHTSVLLSWTAGFNGGLDQQFRIRFR
RTEDETNAYDYTDLIPEDVSLYLIGGLEPGTEYAFSVLGRNALGESEYSEESETTSTLCK
PVYHMYFGRKGEVPRLLLVSVAVVGTLLLLLNAVLVICFVKRRKRRQQQ
Download sequence
Identical sequences B7QHG7
6945.ISCW022951-PA ISCW022951-PA XP_002414624.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]