SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023134-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023134-PA
Domain Number 1 Region: 181-313
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000117
Family Growth factor receptor domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW023134-PA
Sequence length 349
Comment conserved hypothetical protein|DS959833:67310:99002:1|gene:ISCW023134
Sequence
MAPARMLLRTFCLLLVCCAVCKAEIQFATAIDISDLGERAARKDVLSPCQACKTIVETFK
HGVERTSRSRFDGGDGDWEKRKMGKYSSSEIRFIEIQENLCHEVIKGQEHCRNVAGKYEE
HLEDWWFNRQESDPDLHKFLCIERGKACCPENHFGPNCDPCTGGAEKPCGGHGRCRGSGT
RKGSGKCACDAGYSGEVCDTCTPGYFADVTDKGEPVCTKCHQACKGNCTEPGPKACAACN
EGFVMTEEFGCLDVDECVEADTPLCGKNTFCANNEGSYKCMDCDFSCNGCTGDGPDMCVT
CAEGYVLKDKVCVGEAVSKDDGAGEEHKDGLGVTQTPDDDATASHGDEL
Download sequence
Identical sequences B7QKH7
ISCW023134-PA 6945.ISCW023134-PA XP_002415682.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]