SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023368-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023368-PA
Domain Number 1 Region: 207-383
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.94e-28
Family Laminin G-like module 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW023368-PA
Sequence length 396
Comment neurexin IV, putative|DS942248:34089:44713:-1|gene:ISCW023368
Sequence
AHLVQNLVFEPQSARSGAFLFLTPESSALMLCDCCAADNVTETLVHHKNELTTDVKGFRE
PGSFIQDIVYDAPLEQMVQLVNRSTHCRQSLTYECFNARLFDTSDTGPDTFSPYGWWVSR
SNQKMDYWGGSVPGSRKCKCGLYGTCKDPQRYCNCDAGLEEWTMDGGELTDRDYLPVRQL
RFGDTGSASLLEDRKRGRYTLGPLDCQGDALFEDVVTFRYTDATIEVPHLNLRQSWDIYF
HFKTTAENGVLFHNKGPTDYIKLVLIGGDQIQLLYETAGGGPQGVSVETSYKLNNNVWHS
VHVERNKKEARIIVDDSQGAEVKEKPDHSHALNLPGRLVIGASVDYKEGYVGCMRAFLVN
GVPVQLRAHAREGLYGVSLGCVGKCASAPCLNGGFC
Download sequence
Identical sequences B7QHY6
ISCW023368-PA 6945.ISCW023368-PA XP_002414793.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]