SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023486-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023486-PA
Domain Number 1 Region: 241-370
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-18
Family MAM domain 0.027
Further Details:      
 
Domain Number 2 Region: 89-238
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-17
Family MAM domain 0.0078
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000222
Family MAM domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW023486-PA
Sequence length 375
Comment apical endosomal glycoprotein precursor, putative|DS933803:158506:181997:1|gene:ISCW023486
Sequence
GRCFSFWYSMRHPNSGTLNLLLRMENNSTNLLWTRSGPQGRSWARGHVEFYADRAHKFVL
EAILLASTPAVIAVDEIRVTRGECEDKALSCDFEYSGCGWKLNGWEMNSGRKIGTPDVDH
TTETGYGVYARLKSSVGHLASPLLRTIKSSERRCVKFWFYLSGREAEQLNVTRVVSFSVE
SVIWAVRASQVPQRKWLSGSVDLLGDKDALMVAFIGATSSAPDTAVAVDDILIDEKGCPS
AASCDFEDDFCNWWNVGNKTSAMQWYRNSGPTMTDGGPSVDHTLNTARGTYLLLDAQDLS
TVQEGVVESEIIAKASDAACFRLFYQIANGSDASLAVEVRDASGPIVSRWTITGRGNNSW
TPFSQDLNNLPSEYT
Download sequence
Identical sequences B7QGR2
ISCW023486-PA 6945.ISCW023486-PA XP_002400638.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]