SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023666-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023666-PA
Domain Number 1 Region: 1026-1321
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-79
Family Protein kinases, catalytic subunit 0.00000000309
Further Details:      
 
Domain Number 2 Region: 315-477
Classification Level Classification E-value
Superfamily L domain-like 3.4e-40
Family L domain 0.0000104
Further Details:      
 
Domain Number 3 Region: 24-185
Classification Level Classification E-value
Superfamily L domain-like 3.12e-36
Family L domain 0.0000215
Further Details:      
 
Domain Number 4 Region: 600-646,808-828,920-977
Classification Level Classification E-value
Superfamily Fibronectin type III 3.23e-25
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 476-598
Classification Level Classification E-value
Superfamily Fibronectin type III 4.48e-22
Family Fibronectin type III 0.00044
Further Details:      
 
Domain Number 6 Region: 172-322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000107
Family Growth factor receptor domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW023666-PA
Sequence length 1458
Comment insulin receptor, putative|DS968865:1066486:1102194:-1|gene:ISCW023666
Sequence
MAALQKRASVDLAPESQSLRDPGRKICGRIEVRNRISSLVSQLGNCSVVEGSLMVMLTRS
EELWGNVSFPQLTEITGFLFFYRAVGLQSLGRLFPNLAVIRGSELFHNYALVVFEMESLV
ELGLSRLTDIRRGAVRIEKNPNLCHADTVDWGRIAPHAVDGHYIQDNRDPAECSPCPDYC
PQGTGGSRLCWSRERCQKVCPPGCDRNQTTCDDERGDRCCDPKCLGGCAGSSGRGLSMCT
ACLHYTYGNGCVTTCPPSTYVYMGHRCVDEAYCRQRKADGGDSQYRHYIPFNGSCTLECP
SNYVRDDYTCRPCQGRCPKICSSLLVDSVSSAQRVKGCTYINGSLVIQIRGGGNIMKELE
ANLDMIEEIRDYLKVTRSNQLISLNFLKRLRVIHGKALDRLHYSLVVLDNQNLQLLWDWS
SRPKNSSLTLLKGKVFFHINPKLCLTRIKELHEHAKVANWSEQDVSPLTNGDRAACEVHR
INATLQKVGNKIAVVNWSLEFEKQIYDRRSLLGYVVYYREAPFQNVTLFDGRDACQGDVY
VGLWICLWKTADADPGVNMQIIAHLKPFTQYAVYVKAYTLPTAEQGAQSDITYFKTLPAA
PSQPQNLKVTPSKDSKLMISWVPPKYPNGDVRFYRVVGIAQPSAPLHHYLGESRDYCSEG
REGSSPTPEVPDRPVPKAPATPKNGAPAEATCAPCPGQRDRELTEDEAEERSSFEDKVHN
IVFQKRPKKGAGGGDHRRRRSFRERESGEASSNALVATEGPVPVAVSPASSPAPRGDQLL
TEDPCASPSSGNGSEHHHFCGWVANETQMLQEGLHHFTEYSIRVLACHQKLKSKYYRGDP
SDCDTDAVFNGSAMCCSVESITRIRTLPLADADDIDSSTVLVQYENTTVSDSVGAGLLVK
WAPPPDPNGFIVSYQVEYKMVSQEKPFQFCVSHHEFFRHGGRVIHGLAPGNYSFRVMASS
LAGPGNWTRPVYFVIHERSGKHPLLGTVIAICLVVVVMVLAFLAITCVLYQRKKRNPEVP
GGILYASFNPEYVSSVYEPDEWEVPRESINLVKALGQGSFGMVYEGLIYNLKPDKPETKC
AVKTVNESASMRERIEFLQEAAVMKAFSCQHVVKLLGVVSKDQPVYVIMELMSNGDLKSY
LRSHRPPTEGEEDDSKPRGQPPSLKQILQMAAEIADGMAYLTASKFVHRDLAARNCMVAE
DLTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGIFTSHSDVWSYGVVLWEM
ATLASQPYQGLSNEQVLKYVISGGIMEKPENCPEKLYQIMTLCWERNPRLRPNFVQVIEM
LLNDVNSHFREVSFYHTSYLKGQERSGAPGDRPSAPSGAAGGAPSAGDAEDEEEDSTAET
PLRQAPSAGFNPDSSSLNDMDDDRLQRCFSDCIDDDEDDDEDICVGDVKGSKVSNLSNGS
IINGRMCFSQQGSRTTAC
Download sequence
Identical sequences B7QM19
ISCW023666-PA XP_002416224.1.51680 6945.ISCW023666-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]