SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023676-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023676-PA
Domain Number 1 Region: 95-200
Classification Level Classification E-value
Superfamily Immunoglobulin 5.2e-16
Family I set domains 0.029
Further Details:      
 
Domain Number 2 Region: 2-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000244
Family I set domains 0.036
Further Details:      
 
Domain Number 3 Region: 196-289
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000687
Family I set domains 0.029
Further Details:      
 
Weak hits

Sequence:  ISCW023676-PA
Domain Number - Region: 302-392
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0624
Family Fibronectin type III 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW023676-PA
Sequence length 401
Comment sidestep protein, putative|DS968865:1568425:1626105:-1|gene:ISCW023676
Sequence
EPLSVKIQNPQRSFEVDVSAEFRCLVVGSRPLPQVSWWLDEQRLEPFFTDEKANVTAIVL
LLVLTAESDKATLTCRARNPRLDGQLWEDSIILNVLHAPRATLRLGQGLRQERIHEGQDV
YLECGVRANPWVNDVSWTLDGEPLEGNGTTHQGLLVHEQYLVLRNVTAKFSGTYCCHVRN
TRGAALSNLLQLRVQYAPSCKKGMQEVFRYSTSREELSIPCEMDADPEDLTFRWVMKNNS
EVRGDADLVSFSSNGTRSLARYKPAVATEFVSLLCWANNSVGPQKTPCTYFWAFPMSEKT
TGAPKALSGCAVVNQAMTWFFVRCSLDEDRPADQEWYLLEVYHADSGTLLGNVTAKGRPV
FHVDDIPPATECLALAFAVNDHGGRSEPTRVVVQAIPPPSK
Download sequence
Identical sequences B7QM28
XP_002416233.1.51680 ISCW023676-PA 6945.ISCW023676-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]