SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023694-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023694-PA
Domain Number 1 Region: 2674-2958
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.68e-69
Family Protein kinases, catalytic subunit 0.00000156
Further Details:      
 
Domain Number 2 Region: 3381-3659
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.33e-54
Family Protein kinases, catalytic subunit 0.0000445
Further Details:      
 
Domain Number 3 Region: 956-1047
Classification Level Classification E-value
Superfamily Immunoglobulin 2.74e-23
Family I set domains 0.0043
Further Details:      
 
Domain Number 4 Region: 858-950
Classification Level Classification E-value
Superfamily Immunoglobulin 6.9e-23
Family I set domains 0.0042
Further Details:      
 
Domain Number 5 Region: 289-389
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 1928-2025
Classification Level Classification E-value
Superfamily Immunoglobulin 1.41e-22
Family I set domains 0.0075
Further Details:      
 
Domain Number 7 Region: 2127-2216
Classification Level Classification E-value
Superfamily Immunoglobulin 7.59e-22
Family I set domains 0.0085
Further Details:      
 
Domain Number 8 Region: 2229-2321
Classification Level Classification E-value
Superfamily Immunoglobulin 8.01e-22
Family I set domains 0.0054
Further Details:      
 
Domain Number 9 Region: 7-98
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-21
Family I set domains 0.0069
Further Details:      
 
Domain Number 10 Region: 672-769
Classification Level Classification E-value
Superfamily Immunoglobulin 1.78e-21
Family I set domains 0.0046
Further Details:      
 
Domain Number 11 Region: 107-199
Classification Level Classification E-value
Superfamily Immunoglobulin 4.39e-21
Family I set domains 0.0048
Further Details:      
 
Domain Number 12 Region: 386-483
Classification Level Classification E-value
Superfamily Immunoglobulin 4.95e-21
Family I set domains 0.0041
Further Details:      
 
Domain Number 13 Region: 2030-2122
Classification Level Classification E-value
Superfamily Immunoglobulin 6.76e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 14 Region: 1834-1929
Classification Level Classification E-value
Superfamily Immunoglobulin 9.22e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 15 Region: 2562-2655
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-20
Family I set domains 0.0053
Further Details:      
 
Domain Number 16 Region: 577-672
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 17 Region: 1537-1627
Classification Level Classification E-value
Superfamily Immunoglobulin 1.73e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 18 Region: 3156-3252
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-18
Family I set domains 0.0047
Further Details:      
 
Domain Number 19 Region: 1054-1145
Classification Level Classification E-value
Superfamily Immunoglobulin 2.57e-18
Family I set domains 0.053
Further Details:      
 
Domain Number 20 Region: 481-581
Classification Level Classification E-value
Superfamily Immunoglobulin 5.5e-18
Family I set domains 0.0045
Further Details:      
 
Domain Number 21 Region: 765-864
Classification Level Classification E-value
Superfamily Immunoglobulin 6.32e-18
Family I set domains 0.004
Further Details:      
 
Domain Number 22 Region: 1439-1528
Classification Level Classification E-value
Superfamily Immunoglobulin 1.6e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 23 Region: 1735-1825
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-17
Family I set domains 0.0096
Further Details:      
 
Domain Number 24 Region: 1639-1732
Classification Level Classification E-value
Superfamily Immunoglobulin 2.87e-17
Family I set domains 0.0052
Further Details:      
 
Domain Number 25 Region: 2468-2558
Classification Level Classification E-value
Superfamily Immunoglobulin 5.11e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 26 Region: 1344-1432
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 27 Region: 1242-1332
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 28 Region: 212-282
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-16
Family I set domains 0.0058
Further Details:      
 
Domain Number 29 Region: 1145-1235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000083
Family I set domains 0.017
Further Details:      
 
Domain Number 30 Region: 2352-2437
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000186
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 31 Region: 3273-3326
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000113
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW023694-PA
Sequence length 3701
Comment conserved hypothetical protein|DS965098:47618:158344:1|gene:ISCW023694
Sequence
KDASGKPQFQKALRGLTCSQGDNLSLECEVSSPETPTVQWLKDNIPLKKSQRVETKEDAG
KHKLLINEASVEDSGMYTIIASNPQGTASCSAPVYVNPGGTVLPHAPVFKVKLKDTELLE
GTSVRFELVVRGCPEPEVTFYKNGKKLKEDDRVRVIFESKEVFELVIDHISFEDMGKYSC
VAVNSEGKDESSGTITVTSKCIKIAEGSHPLTPPPRSPAFRWFKDGQEFEASERFQVTFD
DIEDNITLVFQHVTPDDAGLYTCVASTSSGKISCSAELTVQGSVIKKSPEAPTIHASLSD
VEVNEGASAMLELKVTGYPKPKITWYKDGQAVIEDDRVKILHPAEDKHALVIDRVKVEDS
GNYSCVISNTTGTQTGFSAVSVNAPPRFIQKLKNYEATETENVTFRIKVSGSPKPKVCWK
KDGKEIKSNKERYQTLEEAENVHCLIIDDVRSEDVAEYSVEISNEYGTETDNASLTITCK
PKIKKKFDDVECSEGERNIKLTIEVEGSPAPKVKWILNETEIREDESFKFESVEDSGKYT
LVIKEAKSDMTGNLTCEAKNEKGKDSCTGSVTVKSKPRIIKGLEDIEVEVGEPATFTVKL
ADGKNVDVKWSKDDCDVVLDNKNIYAKEEADATFTLQIKNVKAEDAGKYTCKVKNELGED
SSTARMSTKSKPFFKKHLVNQEISEEEETVFSAEVGGHPKPSVKWFHGKREIKEDDVYKI
TSDEETYTLKVKKPNKELAGEYTCQAENSCGKEESSASLTIYSKPEIIQGMKDIEGEVGE
AVSFNVKISGSPKPDIVWKRNGEEVSVEATVKVMDQAPSYTLAFDELTIQLAGDYECIAK
NKYGTASTAGKLTVNSKPKFTKSPGDVCIYTGEECVFEAKVAGVPAPEVSWYKAGVKIEE
TERISITTHNGTHRLVIKECNRKDESDYTCTAKNSLGRVSEQAELTVKVPEDSEAPTFIR
RMVDTIAITGDKARLEVRVAGKPTPTVTWYKNGEELTESKRVTITKDGDTHTVTFKDIVK
GDGAKYSCKAENDKGEDEDNAKLIVKGNAPVVHKGLPSKVRVDEGQPLKLEAKIPGHPLP
DIQWLKDGEPVVPSNRVKLSQAPDGTVVLEVDSAKPGDAGHYTVVARNDQGKATSETDVE
IPSTPAFSEGLKDATLTEGCPGKLEAKLSRCSPPPDVEWYKDGEPILPSDHMQPVQEPDG
TVALKIDKVTPDDAGHYSIVAGNDEEKAISDADVKTLVDKKPCFEKGLQPCTLTEGKPAQ
LEAKIAPGGTPTKVEWLKDGRPIRPSDRVRQEEKPDGTLALLIDDVKPEDAGRYSVVASN
DAGEVDSEAPVKTQPDEDTKRKKPAFEKGLEPATLLEGKPAKLEAKLAPGKPTSVKWLKD
GLPIRPSDRVRQEEKPDGSLALIIDDVKPEDAGQYSVVASNDAGEAESEAPVKSKLKKPA
FEKELEPMTLTEGKPAKLEAKLAPGSKPTSVQWLKDGRPIRPSDRVRQEEKPDGTLALCI
DDVKPEDAGRYSVVASNDAGEAESEAPVKSMFKLKKPAFDKELEPMTLTEGKPAKLEAKL
APGSKPTSVKWFKDGRPIRPSDRVRQEEKPDGTLALCIDDVKPEDAGRYSVVASNDAGEA
ESEAPVKTVGDGEGKLKKPAFEKELEPMTLAEGKPARLEAKLAPGSKPTSIKWYKNDRPI
RPSDRVKLEENPDGTLALTIDDVKPEDAGGYAVVAANDAGEADSEADIKTRVPGEKPEFV
IELKNAELLEGQALHLVGKVKSDSPFTVEWLKDGAPLKTSSGLSFSQEPDGTVILSIDHA
TPDDSGKYVCVATNPDGKARIICSLLSEMPKYKPEVVDELKPTVFTEGEPGKLEAKVSGE
PMPDVKWIKDGQELPDDSRIRSTTSPGGDVALTIDPVKPEDAGKYALVAANDEGECRTSA
PVTVNQPPRFTTPLEPVEAVEGYPARLEAKLSGQPTPETEWKKDGKPFIPDGEKIKESKT
PSGDVALIIPKTQPEDAGVYSCKAKNPFGEQETKAPLTVAGKPDTSGEPEEKPTVSPIAD
VNVMESEPFTLETRVTGKPLPEVQWLLDGKPVSTSDNVQQSFDGRKAKLYVKNSRPKDAG
QYECRASNPAGKASATSTVGVTAMSKPRFTKRLTDTEGSPNEPLTLVAKVEGHPEPEITW
KYNGKVIEPSIKYNMSKEGDTCTLTIPWPQSKDSGVYECLAKNPVGEDKCQAQVTMRYVV
AAMVTGEPPCFLKRLENVEVPEGDTARFTARIAGSPLPEVKWFKDGEELERTPRHKFELG
PDGTLRLTIRDCRPEDLGEYRASIYNPYGSDSSMGTLRVKKYDDLDRPYDRRYKPSDQYE
PYSAGVPAALTDKPYIRRMTDRDLTLGWKPYIPSGSRVPVTYNVEMAPLPDGNWTPYKSD
TQLDIRGLEPFKDYRFRVRVGNKYGLSDPSPYVTAHRSRLGGPPPVPKEFKPKDYELEHP
PLDKQGTAPYFVRREEDTMYGIQGHPVSIEFWVYGYPQPNITWTFKGTKIEMGGRYNCMQ
DRNGQVTLFISRMTEDNVGSYTCTAVNEHGEAMKSIYLELAEEPVFTKRLEPTTIMLRRG
GELQCRAIGKPYPKIKWFKDWQPICNSSRVNIIWEAPDICTLTLNDSISRDAGLYSCSAS
NIAGTTSCSAILTIEESQDEFDLNTYRQPKLVRPRSKHIDEYYNLGDELGRGTQGVVYHA
VERPTGKNYAAKMMHGKGQFKDWMKAELDMMNQLCHPRLVRLWDAFETKNSMSLITDLCG
GGELLDNIISRDKLTEHQVANYIRQILEGLNYMHAQNIGHLGLTLGDVLVTRVDSEDIKI
GDFALSARLPRGKTFIQEYGHPEYVAPEIASKKSASLASDMWSVGVISYILLSGISPFLG
QNDRETLKNVQTGKINFLHDGFAKVSDDARDFISKLLVFDPSERLDVRAALAHPWLKVNI
SLFLARFSIPKPVRTSECSVCGCSQYANASCRRHYRRRPMESCFTHPSKMIYPPDEMYTP
PASPEREVEGLKARRQVDDTQPGKGAQDRLDIGSESSYQSGPDTYLLQLRDVDFPLRIRQ
YLRVGASRSPSLAANLRERHWGGFQVVVRERRKFVDVMDEEIDDEKKGLGTRTLPLRLQR
EVGSLGYAHHQLENLKYEAWKDQASRDKTIVHEFFLSAGMVPLFREKIEDCVIKENDDVV
FRCYAVGNPPPQYSWFRNDSILIESSRVQIKQDAEGRSELLLKPGKAYDVGVFKCAARNS
HGVALCYARLKIGGRIVCFVLTMCVYDLVFLCYVFHGESEWKKLCDVITQEFWVARDLQP
STTYLFRVSAKNQFGWSEESLSSDACSTKPEGSAEKIKLSQVHKYQEEIFECDPGHAIRK
DTRVSLDYSQESSPVQLESGSLQELYSFSSEVSVGRFGAVVNGSSKKLSCNLALKTVLAS
SDTESLVLKEYEIMKSLCHERIVALKTASLHDDLLVLGMERLSGMDVLTYLTLRNHYNED
MVAGIIKQVFDGLEYLHFRGICYIELQPDNVVMTDANSCNIKLVDFGSASFVPRTGAVVN
VGKNACIEYLAPEVLKGNDVCHATDIWSVGVLTYILLSGYSPFLGSDEEDTKSNVMYVRY
HFDKLYKEASAEATRFIMQLFKRTPEKRPAISECLENKWMLPSEFMLRKRENSVFHSHKL
QEFAAKFRAKKKNSATADKLSKLLGLSLSRSHFSDGDAVEG
Download sequence
Identical sequences B7QLF1
XP_002416006.1.51680 ISCW023694-PA 6945.ISCW023694-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]