SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023706-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023706-PA
Domain Number 1 Region: 293-545
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-48
Family YWTD domain 0.00000125
Further Details:      
 
Domain Number 2 Region: 624-833
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-40
Family YWTD domain 0.0000249
Further Details:      
 
Domain Number 3 Region: 202-286,539-586
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.73e-23
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 123-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000772
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 5 Region: 5-43
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000106
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 167-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 88-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 8 Region: 47-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW023706-PA
Sequence length 1001
Comment lipophorin receptor, putative|DS959134:685583:743030:1|gene:ISCW023706
Sequence
MSAIPLCGEAEFRCINGGCISIAWRCDKDIDCVDGSDEGGCTAFTSAICLAEDFECRSGR
CVGGAYRCNGDNDCGDWSDEEGCEGKSACQEGEFRCEDGFCINLDWKCDGDADCDDHSDE
RDCAPRQCAPHEFQCHSGKCIQAEWRCDGDFDCSDNSDEDGCGPEGACEPGHFRCLDGTC
IVERLVCNGVPDCPDRSDESQNTTCKSSTPCREDGFPCQHQCMATATGQRCSCKEGYQLA
PDGRSCLDVDECTYEGTCSQSCVNTVPSFQCLCKQGYRLRDDKRHCKAQGPEAYVIFANG
ADIRRITMDKSEYTSVVAKLQNAVALDYHFTLDLVFWSDITVDVIRSCSLTNGTDLRTLV
SRGLANPGGLAVDWIMNRVYWTDSGTSRVESVDLDGRNRRALVWKDLDKPRAIVLYPQLS
TVYWTDWGARPRIERIYTDGSDRRSIVDTSLFWPNGLTIDYASDRIFWADAKHHQLESAD
LDGSNRKKLIESGLPHPFAVTIFEDTLYWTDWQTKSIHTASKFGHQQPSVLYPKLSYPMD
IKVVQRMNPCTTVANKCSHICVSNNESATCACPSGLNLLQDGTSCMERENRRSIIAGLDG
LMNIHVFHRSRPLGDTLELHVYSTWLREKEIYYADADRHVVQSCDTEGRHVRDVISFGLD
TLGGLAVDSVGRKLYWSDSDRSLIEVSELDGRNRHVLFWKDVDSPRAIALHYEKGVMFWT
DWGNKIRIETADMDGDNRMNLVHDGLGWPHGLAIDKQGSRLIWADAKQDVIESVGLDGKN
RRVLVRDIAHPYGVAAFSGNLYWTDWETRAIHQSRLNGHDGHIIRGNLAGLMDLRAIDTE
YADPVFQSTYIALSAVGAALLILLCGALIVWRKKRRRENDVVGRAAPHLGRFPPSHGPGP
ADILEKKPWGWGAKVRYDGTDDKPVSIAAKEKLDNLEVAALVSKRLDELESGMLSISATA
SGDKGYYGLPLNGCPTPPSPPKVPCPRHSPHGQRVYGLLGV
Download sequence
Identical sequences B7QKE3
XP_002415648.1.51680 ISCW023706-PA 6945.ISCW023706-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]