SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023775-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023775-PA
Domain Number 1 Region: 138-330
Classification Level Classification E-value
Superfamily Fibronectin type III 4.47e-36
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 526-631
Classification Level Classification E-value
Superfamily Fibronectin type III 9.89e-25
Family Fibronectin type III 0.00038
Further Details:      
 
Domain Number 3 Region: 783-871
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-24
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 342-439
Classification Level Classification E-value
Superfamily Immunoglobulin 3.78e-23
Family I set domains 0.0039
Further Details:      
 
Domain Number 5 Region: 449-539
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000391
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 44-126
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000119
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 7 Region: 725-791
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000019
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW023775-PA
Sequence length 883
Comment titin, putative|DS970697:184416:241858:-1|gene:ISCW023775
Sequence
MQLTKSKPVPLPSDDADEQDKSEMADQSEPSSPLEFQEEEAWGIEVSGPNAIRLHWGPPA
MGVIQALSYIVEKKDLSDQDWVPVAVVGSDVTSYEVGELDLYAQHWFRVLARSSMGLTTV
YETERPFQLREQERVVVPPSAPVGPLVVESVTEDSVRLSWKQPLKDGGDPVRNYLVEYRD
VSAAEIAKFSVRTPDARTSFTVEDLRTRHFYVFRISAENEAGTGEALVDKKPVRVQAAPK
KPPAPEPPVVVIHPTMPDACIVTWSPPCDDITWYIVERCDLVGDVWIVVSQQKEAQFVAQ
NLVPGIEYSFRVSAENEVGMGKWSKPSEPIVIIRKVASMTAPEFTKDLSDCDVLVDNDAT
FTCKFIGIPTPEITWYKSGHEIYDSGRTEIDTSLATSSLLLRKVRLEDKGKIECQALNNA
GLKTTSAKLTVLAPPKLTGSPTYKDGLMFDSGETVRVKLSYTGHPPPDFTWKRNGEIVVF
DGSSAAMLVDRDDQTVLLKLVDADPNHRGMYTLEATNEHGSDQFSVAVMITGEPEPPEGQ
PVVTSVDWNSCTLSWNPSANDGGSPVSSYIIERRQMNNELWMKATTAHQEHCTVYGLIEG
GQYAFRVRAVTVYGTSKPSQSSEPVTLLRLGPESRAESLPMETNSTEATEAIATEQDFAS
TADDATLTVTKYDSDDQRSSLDVDEFLNEDAAASETVSQVTAPGVSEWSDYDSLVPSSVV
KVETKDSKPLRTNLTTDVIISRDGICRVCLQKVSPADAGVYTCTAENDSGTAASTSILEI
AGLGVPGPPLDPVVTESGPTSATLAWTKPISNGGHPITGYRIQYREVPSKQWRDKATSRI
CVCDIYGLKPQTEYVFQVSAGNKNGWGQPVVAVPELKNWRFFL
Download sequence
Identical sequences B7QMC6
6945.ISCW023775-PA ISCW023775-PA XP_002416331.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]