SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023852-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023852-PA
Domain Number 1 Region: 5-95,144-255,290-403,479-583
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.36e-30
Family Glycerol-3-phosphate transporter 0.046
Further Details:      
 
Weak hits

Sequence:  ISCW023852-PA
Domain Number - Region: 423-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0282
Family Growth factor receptor domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW023852-PA
Sequence length 590
Comment solute carrier organic anion transporter, putative|DS976794:172469:186688:1|gene:ISCW023852
Sequence
FANKKAFLAVFCLTSVLQGMYYTYFVSVLTTIEKLYQIPSKTTGIIMSATEIGQIGGALL
LTYYGGQGHRPKWIACGMLIFAVASILCAMPHFLFIDTSLSVTSLARAKNAQNATVASQW
AKLCHSSDMPLSQSRITHVVLSVFFISLLLIGIGATAVYTLGIPYIDDNVANRESPLYFG
ITIGVRIFGPVFGFLLGSYCTSVYVNFPFETSNLSPGDPHWIGAWWLGVFIVGAALIVTA
LPMMAFPRNLPQRRSLAQLRALRPGSDQHRNGMVCLKHQQALQQKLYIAPSSLSDFPSAI
RRLLKNEILLYRTASSVLHILPIAGLYTFLPKYLESQFRLTETKANMITGFAGILVMGVG
IFASGTFMRKYKPNARFVAKWIAFCALAYSIGMVILMWVGCPLGEYVGLNSEHKGLDFLP
PACNSSCDCKSGLFSPVCHNSVTYLSPCLAGCSQPTFNSCHCTGTNDTISNGFCSLECNN
LVWYIIVFSFFVLIHSTSEVGSMLLTLRCVESHDKALALGLIQFAIGLFGNVPCPIIYGA
VVDSACLFWEDNCGEPGACRVYDPSKFRMVFHGVTAIIMFVAFLVDAVVW
Download sequence
Identical sequences B7QN84
ISCW023852-PA XP_002400770.1.51680 6945.ISCW023852-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]