SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023856-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023856-PA
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000224
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 2 Region: 105-183,223-272
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000426
Family Fibronectin type III 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW023856-PA
Sequence length 283
Comment conserved hypothetical protein|DS979224:149131:158754:-1|gene:ISCW023856
Sequence
LKPWTEYNITLRRFYIAVDEEEILPMKVGRAATVTIRTNPSEPAAPKDVRLVLSEKKNLL
LEIKSPEFWNGPPSKYRIRWEPKDRRRGSSGYRDIDIASTWTPKQKWTTTNVTLEPGLQY
KVFVSAQNSISTGVSFWGPEYANEVTTIPLDPVDLVAESLTPTEVLISWRSAGHSEYFQV
SVITSHISPQPLVSQLNINIYIRLRIYLTHIQYYSLFQISSDSNGEEQFHARVIVDSEQL
ASSEQSLMVDDLLPSRNYTVKVLACTSNECSGKRTAKVTTKPT
Download sequence
Identical sequences B7QNI3
XP_002416488.1.51680 ISCW023856-PA 6945.ISCW023856-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]