SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023873-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023873-PA
Domain Number 1 Region: 67-215
Classification Level Classification E-value
Superfamily Fibronectin type III 2.69e-24
Family Fibronectin type III 0.0046
Further Details:      
 
Domain Number 2 Region: 15-66
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000199
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW023873-PA
Sequence length 256
Comment hypothetical protein|DS973132:757889:777478:1|gene:ISCW023873
Sequence
MSVFLPVQAVEARAGNSEENLREGLLLRNTYLTNLRRLTKYGIVVQAFNAAGTGLASDEV
IATTLETEYVLHYGTEASDWLQLPLNATKQSFVLDGLKCGTLYRLYMTASNSLGTGEPGA
EVSVRTKGAAPISPTTDKFITTNSTTATLHLNAWSTGGCPVTRFAIQYRLKFHPTWLSLA
DSVNPRRRQYQLTDLVPSRQYQVNVIAHSEAGATQADFEFQTPGAVGGRRMNGYAFRALI
KPLHDWVRSESTTKKY
Download sequence
Identical sequences B7QMV8
XP_002400296.1.51680 ISCW023873-PA 6945.ISCW023873-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]