SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW023907-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW023907-PA
Domain Number 1 Region: 702-956
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-38
Family YWTD domain 0.0000552
Further Details:      
 
Domain Number 2 Region: 9-218
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-29
Family YWTD domain 0.0008
Further Details:      
 
Domain Number 3 Region: 318-359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000537
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 357-398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 5 Region: 618-662
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000272
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 655-694
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000534
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 7 Region: 576-611
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000105
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 8 Region: 396-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000119
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 440-476
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 1019-1056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000125
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 484-523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 12 Region: 526-560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 285-319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 14 Region: 244-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000204
Family EGF-type module 0.025
Further Details:      
 
Domain Number 15 Region: 963-1005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000309
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW023907-PA
Sequence length 1200
Comment vitellogenin receptor, putative|DS972524:274666:281286:-1|gene:ISCW023907
Sequence
MPVNRLIMVGAMTLDWATQTLFLSDNPREMILAVDMNTYNVSTIREHHVGSIFGMDFDGQ
NRNLYWVDADKKTIEVCRSNGSGHIILRSDLRRPVDLALHPKAGVMYVLSAGDTPSIVRY
TMDGLSPIRVQLTSMLLGLSLSTDLVAERLFWGDSVRATIEFIDLKNGSSTPFIVEQIHG
HITSVSASHGLVHWTTREDGALYYVDLHVKPTSVHSVPLPPRNGTVARKVIYAAQIPDYA
PGPCSVKNGGCSHVCLPALTSRSCLCPPRMVLSANNVTCKDENGTCSAHELSCAGTCIPA
TYWCDGYQDCSDNSDENNCGTVTCPANGFRCGNGKCVENAWLCDGYNDCGDHSDEINCTR
RNCTSEEYQCRENYCIPVYWRCDGEKDCPDNDDEGNCSLIECPSGYDRCRDGQCFSRDWR
CDGQADCKDSSDELDCGATTGCLPEDFRCTNKECIDPRFRCDRRVDCEDGSDENGCDSSY
TANTTSQCPRGMVNCGDGQCIYEHDICDGYVDCHLGQDERNCTSAMCSSKEVFCINTKRC
ILEAWLCDGEDDCGDNMDETLPRCHPTTTPSTTTTEAACWSDEFRCGSHECVPWSRVCDK
HLDCMDASDEGSHCDTHCGKDNGGCAHICRESPTGPKCSCHPGYYLTGDFKTCEDLDECQ
KPGHCSHFCTNTKGSFKCTCAEGYAIAADRQYCKAQSGEASLLYMLPNQIRSFSMRGHAQ
HLLAQDDLADMHGLDYHFDDKAIYWTEMKEGTINVMLLAKKTPQTVLEDVHRPFHVAVDW
IAGNIYFTDGWVHIQACDYSFKHCADVLETTYSHVNSFTLAANHGIMFWCVWSDVLGKSD
GIIERSNMDGSGRVILVSDKILWPCSLTVDHVHKLLYWSDSNKNVIESATFDGKDRKTIV
MGAISSPFSIALYEDWLYWADWGSDSLMACNRHTGRDKSVVHHGDVKATVLKIVHQVHQP
SGTNRCARNQCEHVCLLTPLSYTCACAHGYKLMDDSHSCFDMENETAYSLQSSDVLKQPC
DPECVNGGICVHNKNKLYCQCPKEFEGLSCEDPVVLALPVADQASNSMWLASVLIFILCV
ALLAFGYLFYRRNRHKLSAVDFTVGFKTPTFAAKDEGLLENEHPIAEDYHVVAASQPGFK
NPLFLDGHKSHLLTENGEFQRWSSNESVVSSVGVDDSQATLAATEDETKQKKQVFFFRKV
Download sequence
Identical sequences B7QMR1
ISCW023907-PA XP_002400096.1.51680 6945.ISCW023907-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]