SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW024106-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW024106-PA
Domain Number - Region: 25-182
Classification Level Classification E-value
Superfamily ARM repeat 0.0863
Family HspBP1 domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW024106-PA
Sequence length 208
Comment hypothetical protein|DS668443:4939:9472:1|gene:ISCW024106
Sequence
CRQVLLRDAGIITELIEDVILRTKQDSSCDMRKLRQAGYGALCLWLQTMRTGVGLRGSLG
KLLPVMLQDAESVGAATVELSSRNVKHQESRKGHVKVQESLQPEVRAQLCEQALKALSAL
ISTYGTVMEPDALREVQSSVIHLLLRIQQQLQQGSPDALCQPYHSPSCRQALYALLLTLL
VHPHPGCPPTLSCTVRLFSAGQRDSCIQ
Download sequence
Identical sequences B7PA14
ISCW024106-PA 6945.ISCW024106-PA XP_002406002.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]