SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW024316-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ISCW024316-PA
Domain Number - Region: 139-264
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00073
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number - Region: 49-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00525
Family C1 set domains (antibody constant domain-like) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW024316-PA
Sequence length 351
Comment conserved hypothetical protein|DS768284:538:1593:-1|gene:ISCW024316
Sequence
GPAGLGEAANSGMPRSSGEATSRAEVLAGLKVEYARAYIAAEEPDNDSGPMELLCTVGFK
EYASITWTVNGRPLENFIDRSSLTTIKNEVPVKVSKITINQLERLPSDNGKFIFECTALV
DAQVTKATIALGSIIEDTCTTNGQCEARGASCSEGRCLCKASQPVSLKSKHLTCRAAANL
GWPCDYSEQCSFVQPNSVCSDSLVCICSLGFVRSLDGKICDKLTPGNLIGSACKENADCH
SAGASCANSVCKCTNDTVERGGLCLPLAHLKLGLETLRGTNFLGAEDSIKSIHNDTRFTV
AAAMINDASDKTTASTALSPPPLSGAADSAPTSYLALLSGTLTMIILARGP
Download sequence
Identical sequences B7PQV7
ISCW024316-PA XP_002436149.1.51680 6945.ISCW024316-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]